Detailed information of regulator

Summary

Regulator ID	REG0264
Regulator type	protein
Regulatory pathway (from literatures)	Tpp; QS regulatory pathway
KEGG pathway (determined by BlastKOALA)	Biofilm formation - Pseudomonas aeruginosa (map02025)
Related T6SS	T6SS00793 (Type i1)
Strain	Vibrio alginolyticus strain EPJS
Replicon	chromosome
Sequence	Protein sequence (223 a.a.); Nucleotide sequence (669 bp)
Description	The microarray results showed that deletion of T6SSVA2 gene pppA could induce the transcription of T6SSVA1 gene hcp1; The microarray results showed that deletion of T6SSVA2 gene pppA could induce the transcription of T6SSVA1 gene hcp1. Western blot analysis of whole cell proteins confirmed the increased expression of Hcp1 in △pppA mutant compared to wild type; Hcp1 (VEPGS_0021) was induced in △luxR. In contrast, clpV1 (VEPGS_0022), icmF1 (VEPGS_0007)and vasA1 (VEPGS_0010) were distinctly repressed in the △luxR mutant
Reference	[1] Sheng L, Lv Y, Liu Q, et al. Connecting type VI secretion, quorum sensing, and c-di-GMP production in fish pathogen Vibrio alginolyticus through phosphatase PppA. Vet Microbiol. 2013 Mar 23;162(2-4):652-662. doi: 10.1016/j.vetmic.2012.09.009. Epub 2012 Sep 14. PMID: 23021863 [2] Sheng L, Gu D, Wang Q, et al. Quorum sensing and alternative sigma factor RpoN regulate type VI secretion system I (T6SSVA1) in fish pathogen Vibrio alginolyticus. Arch Microbiol. 2012 May;194(5):379-90. doi: 10.1007/s00203-011-0780-z. Epub 2011 Dec 16. PMID: 22173829

---

External database links

Locus tag (Gene)	VEPGS_0621 (pppA)
Coordinates (Strand)	23577..24245 (+)
NCBI ID	225382187
GenBank	FJ790777
Uniprot ID	C0LZR1_VIBAL
KEGG ID	-
KEGG pathway (determined by BlastKOALA)	map02025
PDB ID	-

---

  Target

Target	Regulation (↓/↑)	Target sequence
Unknown	↑	-
T6SS1 transcript	↑	-
hcp1 transcript	↓	-

---

Pfam domain hit(s) of regulator

Domain	Pfam ID	E-value	Aligned region
T6SS_TssG	PF06996.13	1.9e-40	11..208

---

Transmembrane helices

• Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction	Region	Sequence
Outside	1-222	MSAEQFYRELKQHPLFEAIHLIEHEVLQAEAQIGTDALPKHEKLNLKVNPSLGLENAQLCELKNIDDNELEIETNLIGLTGEQGVLPQHYSELALHRQKEGDTAMVDFYDIFNHRLLSLYYRCWQLSQLTVQSRAHAQGARSPLESCKSALTGEGSSLSRHYGGVFASPMRSKGGLKSILECLSGCQVKFMNFKDNGYTLRKKSKHALHPELCLKGSLLNLV

---

Signal peptides

Prediction	Probability	Cleavage site	Signal peptide sequence
Other	0.9963	-	-

---

  Protein sequence of regulator: 223 a.a.    .Download


  Nucleotide sequence of regulator: 669 bp    .Download