Detailed information of regulator


Summary

Regulator ID REG0198 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Cysteine and methionine metabolism (map00270); Quorum sensing (map02024)
Related T6SS T6SS00256 insolico (Type i1); T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (217 a.a.); Nucleotide sequence (651 bp)
Description the expression of T6SS1 was upregulated in the ypsIytbI and ypsRytbR double mutants compared to the YPIII parent strain.; T6SS4 promoter activity was signiWcantly reduced in the ypsIytbI double mutant in which the QS system was completely inactivated and T6SS4 promoter activity was strongly reduced in the ypsI mutant. Exogenously adding AHLs extracted from the AHL producer E. coli DH5 (pJZ365) resulted in a substantial recovery of T6SS4 expression in the ypsIytbI mutant.
Reference

External database links

Locus tag (Gene) YPK_RS03970 (ytbI)
Coordinates (Strand) 901200..901850 (-)
NCBI ID 488144695
RefSeq NC_010465
Uniprot ID Q666J8_YERPS, A0A0U1QV91_YERP3, A0A0E1NPQ8_YERPA, A0A0H2YM92_YERPN, A0A0H3B0B9_YERPY
KEGG ID ypy:YPK_0792, ypn:YPN_3182, ypo:BZ17_3351, yps:YPTB3258, ypa:YPA_0280, ypi:YpsIP31758_0719
KEGG pathway (determined by BlastKOALA) map01100; map00270; map02024
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcripts -
T6SS4 transcripts and hcp secretion -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Autoind_synth PF00765.19 9.4e-67 14..187

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-216 MLEIFDVRYDELTDIRSEDLYKLRKKTFKDRLNWEVNCSNGMEFDEYDNSDTRYLLGIYQGQLICSVRFIELHLPNMITHTFNALFDDVALPKRGYIESSRFFVDKTRAKLLFGNHYPISYLFFLSIINYSRHNGYTGIYTIVSRAMLTILKRSGWQVEVIKEAHITEKERIYLLHLPIDRDNQARLLLQVNQRLQDPCSVLSTWPISLPVMPESA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9928 - -



  Protein sequence of regulator: 217 a.a.    .

>REG0198 NC_010465:c901850-901200 [Yersinia pseudotuberculosis YPIII]
MLEIFDVRYDELTDIRSEDLYKLRKKTFKDRLNWEVNCSNGMEFDEYDNSDTRYLLGIYQGQLICSVRFIELHLPNMITH
TFNALFDDVALPKRGYIESSRFFVDKTRAKLLFGNHYPISYLFFLSIINYSRHNGYTGIYTIVSRAMLTILKRSGWQVEV
IKEAHITEKERIYLLHLPIDRDNQARLLLQVNQRLQDPCSVLSTWPISLPVMPESA*

  Nucleotide sequence of regulator: 651 bp    .

>REG0198 NC_010465:c901850-901200 [Yersinia pseudotuberculosis YPIII]
ATGTTAGAAATTTTCGATGTCAGATACGACGAGTTGACCGATATACGGTCTGAGGACCTGTATAAATTAAGGAAAAAGAC
GTTTAAGGATCGTCTTAACTGGGAGGTGAATTGCAGCAACGGCATGGAGTTTGATGAATATGATAATTCGGATACACGCT
ATCTCCTTGGTATTTACCAAGGTCAACTAATCTGCAGTGTGCGTTTTATAGAACTTCACCTGCCTAATATGATCACTCAT
ACCTTCAATGCACTCTTCGATGACGTGGCATTACCTAAGAGGGGCTATATAGAATCGAGCCGTTTCTTCGTTGATAAAAC
CCGTGCCAAGTTGCTTTTTGGTAACCATTACCCCATAAGCTACTTATTCTTTTTATCGATTATTAATTACTCCCGACATA
ATGGCTACACAGGTATTTATACTATCGTCAGCCGAGCAATGTTGACCATCCTTAAACGATCAGGCTGGCAGGTTGAGGTG
ATTAAAGAAGCACATATTACCGAAAAAGAAAGGATATACTTACTGCATCTCCCGATAGATCGGGACAATCAAGCACGGCT
GCTTTTACAGGTTAATCAGCGTTTGCAGGATCCATGTTCAGTATTAAGTACATGGCCTATATCGTTGCCCGTTATGCCAG
AATCGGCTTAA