Detailed information of regulator


Summary

Regulator ID REG0186 experimental
Regulator type protein
Regulatory pathway (from literatures) Unknown
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00225 experimental (Type i3)
Strain Yersinia pseudotuberculosis IP 31758
Replicon chromosome
Sequence Protein sequence (781 a.a.); Nucleotide sequence (2343 bp)
Description Transposon mutagenesis identifies LptD as candidate for T6SS-4 regulation and overproduction of OmpR led to an increased fluorescence and β-galactosidase activity compared to the lptD strain carrying the empty vector, at levels comparable to the WT strain.
Reference

External database links

Locus tag (Gene) YpsIP31758_3441 (lptD)
Coordinates (Strand) 3878499..3880841 (+)
NCBI ID 499505072
RefSeq NC_009708
Uniprot ID LPTD_YERPS, A0A0U1R3A1_YERP3
KEGG ID ypi:YpsIP31758_3441, yps:YPTB0636
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
YpsIP31758_3980 (ompR) -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
LptD PF04453.16 5.5e-107 307..693
LptD_N PF03968.16 1e-29 53..193

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-780 MKKRFPTLLATLIWTALYSQHTLADLAEQCMLGVPTYDQPLVTGDPNQLPVRINADKTEANYPDNALFTGNVIVQQGNSTLTANQVELTQVQKPGEVIPLRTVTATGDVNYDDPQIKLKGPKGWSNLNTKDTDIDKGKYQMVGRQGRGDADLMKLRDQSRYTILKNGTFTSCLPGDNSWSVVGSEVIHDREEQVVEVWNARFKIGKVPVFYSPYMQLPVGDKRRSGFLIPNAKFTSNNGFEFLLPYYWNIAPNFDATITPHYMERRGLQWQNEFRYLLAPGSGTMALDWLPNDRIYTGPDGTDKNATRWLYYWGHSGVMDQVWRFNINYTRVSDPAYFTDLTSQYGSTTDGYATQIFTAGYANENWNATLSSKQFQVFTAAGNSNAYRAQPQLDMNYYKNDVGPFDMHVYGQAAKFTSVNPTNPEASRFHIEPTVNLPLSNSWGSINTEAKLLATHYQQDIPASFADNASNPKLKDSVNRVLPQFKVDGKVVFDRSMDWATGFTQTLEPRAQYLYVPYRNQDDIYIYDTTLMQSDYSGLFRDRTYSGLDRIASANQVSTGLTSRIYDDARVERFNVSVGQIYYFSRSRTGNTEAIDNSNDTGSLVWAGDTFWRINDQLGLKGGAQYDTRLGSLTLGNAIMEYRRDADRMIQLNYRYASPKYIQAAVPKVYNPDYQQGISQVGTTASWPIADRWAIVGAYYYDTKAKQPASQLVGLQYNTCCWAVNLGYERKITGWNAQGQTSKYDNKIGFNIELRGLSGGHSLGTAQMLNSGILPYQSAF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9870 pos: 24-25. TLA-DL. MKKRFPTLLATLIWTALYSQHTLA



  Protein sequence of regulator: 781 a.a.    .

>REG0186 NC_009708:3878499-3880841 [Yersinia pseudotuberculosis IP 31758]
MKKRFPTLLATLIWTALYSQHTLADLAEQCMLGVPTYDQPLVTGDPNQLPVRINADKTEANYPDNALFTGNVIVQQGNST
LTANQVELTQVQKPGEVIPLRTVTATGDVNYDDPQIKLKGPKGWSNLNTKDTDIDKGKYQMVGRQGRGDADLMKLRDQSR
YTILKNGTFTSCLPGDNSWSVVGSEVIHDREEQVVEVWNARFKIGKVPVFYSPYMQLPVGDKRRSGFLIPNAKFTSNNGF
EFLLPYYWNIAPNFDATITPHYMERRGLQWQNEFRYLLAPGSGTMALDWLPNDRIYTGPDGTDKNATRWLYYWGHSGVMD
QVWRFNINYTRVSDPAYFTDLTSQYGSTTDGYATQIFTAGYANENWNATLSSKQFQVFTAAGNSNAYRAQPQLDMNYYKN
DVGPFDMHVYGQAAKFTSVNPTNPEASRFHIEPTVNLPLSNSWGSINTEAKLLATHYQQDIPASFADNASNPKLKDSVNR
VLPQFKVDGKVVFDRSMDWATGFTQTLEPRAQYLYVPYRNQDDIYIYDTTLMQSDYSGLFRDRTYSGLDRIASANQVSTG
LTSRIYDDARVERFNVSVGQIYYFSRSRTGNTEAIDNSNDTGSLVWAGDTFWRINDQLGLKGGAQYDTRLGSLTLGNAIM
EYRRDADRMIQLNYRYASPKYIQAAVPKVYNPDYQQGISQVGTTASWPIADRWAIVGAYYYDTKAKQPASQLVGLQYNTC
CWAVNLGYERKITGWNAQGQTSKYDNKIGFNIELRGLSGGHSLGTAQMLNSGILPYQSAF*

  Nucleotide sequence of regulator: 2343 bp    .

>REG0186 NC_009708:3878499-3880841 [Yersinia pseudotuberculosis IP 31758]
ATGAAAAAAAGATTCCCAACACTGCTGGCCACATTGATTTGGACGGCACTATATAGTCAACACACACTGGCAGACCTTGC
GGAGCAATGTATGCTCGGTGTCCCAACCTATGATCAACCACTGGTCACAGGCGATCCGAATCAACTGCCGGTCCGTATTA
ATGCGGATAAAACCGAAGCAAACTATCCGGATAATGCCTTGTTTACTGGCAATGTTATTGTTCAGCAAGGCAATAGCACC
CTAACAGCGAACCAAGTGGAACTGACACAGGTACAGAAACCCGGTGAAGTCATTCCCCTTCGTACCGTTACCGCCACCGG
CGATGTCAACTACGACGATCCGCAAATCAAGCTGAAAGGACCAAAAGGTTGGTCAAATCTGAACACCAAAGATACTGATA
TAGACAAAGGTAAATATCAGATGGTGGGCCGTCAGGGCCGTGGTGATGCAGATTTGATGAAATTGCGCGATCAGAGCCGC
TACACCATTTTGAAAAACGGCACATTTACCTCTTGCCTACCCGGAGATAACAGTTGGAGCGTGGTTGGCTCAGAGGTCAT
TCATGACCGCGAAGAACAAGTGGTTGAAGTTTGGAATGCTCGTTTCAAGATTGGCAAAGTCCCGGTGTTTTACAGCCCTT
ATATGCAATTGCCAGTTGGCGATAAACGCCGTTCGGGGTTCTTGATCCCAAATGCGAAATTTACCAGTAACAATGGTTTT
GAGTTTTTACTCCCTTATTACTGGAATATTGCCCCCAACTTTGATGCCACCATTACGCCACACTATATGGAAAGGCGCGG
GTTGCAATGGCAAAACGAATTCCGCTATTTGCTGGCGCCGGGTTCAGGCACCATGGCATTAGACTGGTTGCCCAATGACC
GTATCTATACGGGGCCTGATGGCACAGATAAAAATGCCACCCGCTGGTTATACTACTGGGGCCATTCCGGTGTAATGGAT
CAAGTTTGGCGCTTCAACATCAACTATACCCGTGTCAGCGACCCCGCTTACTTTACGGATTTAACCTCTCAGTACGGTTC
GACAACCGATGGCTACGCGACACAAATATTCACCGCCGGTTATGCCAATGAAAACTGGAATGCGACGCTGTCTTCCAAGC
AGTTCCAGGTATTTACTGCTGCAGGTAACAGTAATGCCTACCGTGCCCAGCCACAGTTGGACATGAACTACTACAAAAAC
GATGTTGGTCCATTTGATATGCATGTCTATGGTCAGGCGGCCAAATTCACCAGTGTCAATCCAACTAACCCGGAAGCCAG
CCGTTTCCATATTGAACCTACGGTTAACCTGCCCTTATCCAATAGCTGGGGAAGCATAAATACAGAAGCCAAACTGTTGG
CCACCCACTATCAACAGGATATTCCGGCCAGTTTTGCTGACAATGCTAGCAACCCCAAACTGAAAGACTCAGTAAACCGG
GTCCTACCACAGTTTAAAGTGGATGGTAAGGTGGTATTCGATAGGTCAATGGACTGGGCGACGGGCTTTACGCAGACATT
GGAGCCTCGCGCACAGTATCTCTACGTCCCTTACCGGAACCAAGATGATATCTATATATATGACACCACGTTGATGCAGT
CGGATTACTCTGGTCTGTTCCGTGATCGTACCTATAGTGGCTTGGACCGTATTGCATCGGCTAATCAGGTATCTACCGGT
TTAACCTCTCGCATATATGATGATGCTCGGGTTGAACGTTTTAATGTTTCTGTAGGTCAAATCTATTACTTCAGTCGATC
ACGCACAGGTAATACCGAAGCCATCGATAACAGTAACGATACAGGGAGCCTGGTTTGGGCTGGTGATACTTTTTGGCGGA
TCAACGATCAACTGGGCCTGAAGGGCGGCGCACAGTATGATACTCGGCTGGGAAGTTTGACCTTAGGTAACGCTATAATG
GAATATAGAAGAGACGCTGATCGTATGATTCAATTGAATTACCGCTACGCGAGCCCAAAATATATTCAGGCGGCTGTCCC
TAAAGTATACAACCCTGACTACCAGCAAGGCATCTCTCAGGTAGGTACCACGGCCAGTTGGCCAATTGCTGACCGCTGGG
CGATCGTCGGGGCGTATTATTACGATACCAAAGCCAAACAACCTGCCAGCCAGTTAGTTGGCTTGCAATACAACACCTGT
TGTTGGGCGGTAAACCTTGGCTATGAACGCAAAATAACTGGCTGGAATGCACAAGGCCAAACCAGTAAGTACGACAACAA
AATAGGCTTTAACATCGAATTACGTGGTTTGAGCGGTGGTCATAGCCTTGGTACTGCTCAAATGCTGAACTCGGGCATTC
TGCCTTATCAAAGTGCATTCTGA