Detailed information of regulator


Summary

Regulator ID REG0168 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Biosynthesis of secondary metabolites (map01110); Phenazine biosynthesis (map00405); Quorum sensing (map02024); Biofilm formation - Pseudomonas aeruginosa (map02025)
Related T6SS T6SS00150 experimental (Type i3); T6SS00152 experimental (Type i1)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (302 a.a.); Nucleotide sequence (906 bp)
Description pqsE, which is part of the operon required for the production of the MvfR ligands, is indispensable for most MvfR-dependent gene expression, and in ΔpqsE cells, the expression profiles of HSI-II genes were unchanged compared with those in wild-type cells while some HSI-III genes were downregulated.
Reference

External database links

Locus tag (Gene) PA14_51380 (pqsE)
Coordinates (Strand) 4566077..4566982 (-)
NCBI ID 489176725
RefSeq NC_008463
Uniprot ID V6AJG5_PSEAI, A0A0H2Z6F6_PSEAB, PQSE_PSEAE, A0A072ZMX8_PSEAI
KEGG ID pau:PA14_51380, pae:PA1000
KEGG pathway (determined by BlastKOALA) map01110; map00405; map02024; map02025
PDB ID 2Q0I, 5HIO, 2Q0J, 5HIQ, 7KGW, 2VW8, 5HIP, 5HIS, 7KGX, 3DH8

  Target
Target Regulation (↓/↑) Target sequence
T6SS Transciption -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Lactamase_B PF00753.29 5.6e-27 18..221

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-301 MLRLSAPGQLDDDLCLLGDVQVPVFLLRLGEASWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKSESAVRVVERLNRQLLRAEQRLPEACAWDALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLLQLIPGHGGLLRGRLAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVDFLPGELHLGSMRRMLEILSRQALPLD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9943 - -



  Protein sequence of regulator: 302 a.a.    .

>REG0168 NC_008463:c4566982-4566077 [Pseudomonas aeruginosa UCBPP-PA14]
MLRLSAPGQLDDDLCLLGDVQVPVFLLRLGEASWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPY
LCPRLPNVQVLASERTCQAWKSESAVRVVERLNRQLLRAEQRLPEACAWDALPVRAVADGEWLELGPRHRLQVIEAHGHS
DDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLLQLIPGHGGLLRGRLAADGAESAYTE
CLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVDFLPGELHLGSMRRMLEILSRQALPLD*

  Nucleotide sequence of regulator: 906 bp    .

>REG0168 NC_008463:c4566982-4566077 [Pseudomonas aeruginosa UCBPP-PA14]
ATGTTGAGGCTTTCGGCTCCCGGTCAACTGGATGATGACCTGTGCCTGTTGGGGGACGTCCAGGTGCCGGTGTTTCTGCT
GCGTCTCGGTGAGGCGAGCTGGGCGCTGGTTGAAGGAGGGATCAGCCGGGATGCCGAATTGGTTTGGGCGGACCTGTGCC
GCTGGGTCGCCGATCCGTCCCAGGTGCACTACTGGCTGATCACCCACAAGCACTACGACCACTGCGGCCTGCTGCCCTAC
CTGTGTCCGCGGCTGCCGAACGTACAGGTCCTGGCGTCCGAGCGGACCTGCCAGGCCTGGAAGTCGGAAAGCGCGGTGCG
GGTGGTCGAGCGCTTGAACCGGCAACTGTTGCGTGCGGAGCAGCGGTTGCCCGAGGCCTGTGCCTGGGACGCTCTGCCGG
TTCGCGCGGTGGCCGACGGCGAGTGGCTGGAGCTGGGACCGCGGCATCGCCTGCAGGTCATAGAGGCCCACGGCCACAGC
GACGATCACGTGGTTTTCTACGACGTGCGACGCCGACGCCTGTTCTGCGGCGATGCCCTGGGCGAGTTCGACGAGGCAGA
GGGGGTGTGGCGGCCGCTGGTGTTCGACGACATGGAGGCTTACCTGGAGTCCCTGGAACGTCTGCAGCGTCTGCCGACCC
TGCTGCAACTGATCCCGGGACACGGCGGCCTGCTGCGGGGGCGGCTGGCCGCGGATGGGGCCGAGTCGGCCTATACCGAG
TGTCTGCGCCTGTGCCGGCGGTTGCTCTGGCGCCAGTCCATGGGCGAGTCCCTCGACGAACTGAGCGAGGAGCTGCACCG
CGCCTGGGGTGGGCAGAGCGTCGACTTCCTGCCCGGCGAACTGCACCTGGGGAGCATGCGCCGGATGCTGGAGATTCTCT
CCCGCCAGGCGCTGCCTCTGGACTGA