Detailed information of regulator


Summary

Regulator ID REG0150 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-HK
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00086 experimental (Type i4b)
Strain Pseudomonas syringae pv. syringae B728a
Replicon chromosome
Sequence Protein sequence (918 a.a.); Nucleotide sequence (2754 bp)
Description Transcript levels of hcp, icmF, algA, and pslB were significantly lower in the B728a ΔgacS strain (5.3-, 3.1-, 15.4-, and 7.7-fold, respectively) than in wild-type B728a.
Reference

External database links

Locus tag (Gene) Psyr_3698 (gacS)
Coordinates (Strand) 4385550..4388303 (+)
NCBI ID 499587812
RefSeq NC_007005
Uniprot ID Q4ZQ42_PSEU2, A0A132FM50_PSESY
KEGG ID psb:Psyr_3698
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02025; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcription -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
HATPase_c PF02518.28 4.1e-28 396..511
Response_reg PF00072.26 1.2e-27 669..783
HisKA PF00512.27 6.4e-22 285..349
sCache_4 PF09984.11 2.3e-16 35..168
Hpt PF01627.25 1.7e-10 830..911
HAMP PF00672.27 3.7e-10 190..240

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-9 VLTKLGIKG
Transmembrane helix 10-32 RVLLLTILPASLMAAMLGGYFTW
Inside 33-168 MQLSELQSQLLQRGEMIAQDLAPLAANALGRKDKVLLSRIATQTLEQTDVRAVSFLDTDRTVLAHAGPTMISPSPIGSGSQLLSSTGTDATRYLLPVFGSQRHLTSPIIPAEADTLLGWVELEISHNGTLLRGYRS
Transmembrane helix 169-188 LFASLLLILTGLAFTATLAV
Outside 189-917 RMSRTINGPMSQIKQAVSQLKDGNLETRLPPLGSRELDELASGINRMAATLQNAQEELQLSIDQATEDVRQNLETIEIQNIELDLARKEALEASRIKSEFLANMSHEIRTPLNGILGFTHLLQKSELTPRQFDYLGTIEKSADNLLSIINEILDFSKIEAGKLVLDNIPFNLRDLLQDTLTILAPAAHAKQLELVSLVYRDTPLALSGDPLRLRQILTNLVSNAIKFTREGTIVARAMLEDETEEHAQLRISVQDTGIGLSSQDVRALFQAFSQADNSLSRQPGGTGLGLVISKRLIEQMGGEIGVDSTPGEGSEFWISLKLPKAREDKEESLNIPLGGLRAAVLEHHDLARQALEHQLEDCGLQTIVFNNLENLLNGVTAAHETPAAIDLAVLGVTALEISPERLRQHIWDLENLNCKVMVLCPTTEHALFQLAVHDVYTQLQAKPACTRKLQKALSELIAPRAVRADIGPPLSSRAPRVLCVDDNPANLLLVQTLLEDMGAEVVAVEGGYAAVNAVQQEAFDLVLMDVQMPGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRSLLQSGMDDYLTKPISERQLAQVVLKWTGLALRNPAPERQNEALEVHVGPLVLDHEEGLRLAAGKADLAADMLAMLLASLDADREAIRVARANQDVHALIERIHRLHGATRYCGVPQLRSACQRAETLLKQNAPHTEEALNDLDKAIIRLEAEARVMA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9592 - -



  Protein sequence of regulator: 918 a.a.    .

>REG0150 NC_007005:4385550-4388303 [Pseudomonas syringae pv. syringae B728a]
VLTKLGIKGRVLLLTILPASLMAAMLGGYFTWMQLSELQSQLLQRGEMIAQDLAPLAANALGRKDKVLLSRIATQTLEQT
DVRAVSFLDTDRTVLAHAGPTMISPSPIGSGSQLLSSTGTDATRYLLPVFGSQRHLTSPIIPAEADTLLGWVELEISHNG
TLLRGYRSLFASLLLILTGLAFTATLAVRMSRTINGPMSQIKQAVSQLKDGNLETRLPPLGSRELDELASGINRMAATLQ
NAQEELQLSIDQATEDVRQNLETIEIQNIELDLARKEALEASRIKSEFLANMSHEIRTPLNGILGFTHLLQKSELTPRQF
DYLGTIEKSADNLLSIINEILDFSKIEAGKLVLDNIPFNLRDLLQDTLTILAPAAHAKQLELVSLVYRDTPLALSGDPLR
LRQILTNLVSNAIKFTREGTIVARAMLEDETEEHAQLRISVQDTGIGLSSQDVRALFQAFSQADNSLSRQPGGTGLGLVI
SKRLIEQMGGEIGVDSTPGEGSEFWISLKLPKAREDKEESLNIPLGGLRAAVLEHHDLARQALEHQLEDCGLQTIVFNNL
ENLLNGVTAAHETPAAIDLAVLGVTALEISPERLRQHIWDLENLNCKVMVLCPTTEHALFQLAVHDVYTQLQAKPACTRK
LQKALSELIAPRAVRADIGPPLSSRAPRVLCVDDNPANLLLVQTLLEDMGAEVVAVEGGYAAVNAVQQEAFDLVLMDVQM
PGMDGRQATEAIRAWEAERNQSSLPIVALTAHAMANEKRSLLQSGMDDYLTKPISERQLAQVVLKWTGLALRNPAPERQN
EALEVHVGPLVLDHEEGLRLAAGKADLAADMLAMLLASLDADREAIRVARANQDVHALIERIHRLHGATRYCGVPQLRSA
CQRAETLLKQNAPHTEEALNDLDKAIIRLEAEARVMA*

  Nucleotide sequence of regulator: 2754 bp    .

>REG0150 NC_007005:4385550-4388303 [Pseudomonas syringae pv. syringae B728a]
GTGCTGACCAAGCTGGGTATAAAAGGCCGTGTGCTGCTACTGACTATTTTGCCTGCCAGCCTGATGGCGGCGATGCTCGG
TGGCTATTTCACCTGGATGCAGTTGAGCGAACTGCAAAGCCAGCTGCTGCAACGCGGCGAAATGATCGCCCAGGATCTGG
CGCCCCTTGCCGCCAATGCACTGGGGCGCAAGGACAAAGTACTGCTCAGTCGCATCGCCACCCAGACGCTGGAACAGACC
GACGTGCGCGCCGTGTCGTTTCTCGACACCGATCGCACGGTACTGGCCCACGCCGGGCCGACCATGATCAGCCCGTCGCC
GATTGGCAGCGGGTCGCAGTTGCTCAGCTCGACCGGCACCGACGCCACGCGCTACCTGCTGCCGGTATTCGGCAGTCAAC
GCCACCTGACCAGCCCGATCATTCCTGCCGAAGCCGACACCCTGCTGGGCTGGGTCGAGCTTGAAATATCCCATAACGGT
ACGCTGCTGCGCGGCTACCGAAGCCTGTTTGCCAGCCTGCTGCTGATCCTCACCGGGCTGGCGTTCACCGCAACCCTCGC
GGTACGCATGAGCCGCACCATCAACGGGCCGATGAGCCAGATCAAGCAGGCCGTGTCGCAACTCAAGGACGGCAATCTGG
AAACCCGTCTGCCACCGCTGGGCAGCCGCGAGCTGGACGAACTGGCGTCGGGCATCAACCGCATGGCGGCGACGCTGCAG
AACGCGCAGGAAGAACTGCAACTGAGCATCGATCAGGCGACCGAGGATGTCCGGCAGAATCTGGAGACCATCGAAATCCA
GAACATCGAACTGGACCTGGCCCGTAAGGAAGCGCTTGAAGCAAGCCGGATCAAGTCCGAATTCCTGGCCAACATGAGCC
ATGAAATCCGCACGCCGCTCAATGGCATTCTGGGCTTCACCCATTTGCTGCAGAAAAGCGAACTGACGCCGCGCCAGTTC
GACTACCTGGGCACCATCGAGAAGTCCGCCGACAACCTGTTGAGCATCATCAACGAGATTCTCGACTTCTCGAAGATCGA
GGCCGGCAAGCTGGTGCTCGACAATATCCCGTTCAACCTGCGCGACCTGTTGCAGGACACCCTGACCATCCTCGCCCCGG
CGGCGCACGCCAAACAGCTGGAACTGGTCAGTCTGGTGTACCGCGATACGCCACTGGCGCTGTCCGGCGACCCGCTGCGT
CTGCGGCAGATCCTGACCAATCTGGTCAGCAACGCGATCAAGTTCACCCGCGAAGGCACGATCGTCGCGCGCGCCATGCT
CGAAGATGAAACCGAAGAGCACGCGCAACTGCGCATCAGCGTGCAGGACACCGGGATCGGCCTGTCCAGTCAGGATGTGC
GAGCGCTGTTCCAGGCCTTCAGCCAGGCCGACAACTCGCTCTCGCGCCAACCGGGCGGTACCGGACTGGGTCTGGTGATC
TCCAAGCGCCTGATCGAACAGATGGGCGGTGAAATCGGTGTCGACAGCACACCGGGCGAAGGTTCGGAATTCTGGATCAG
CCTGAAACTGCCCAAGGCCCGCGAAGACAAGGAAGAATCACTCAATATTCCGCTCGGCGGCCTGCGCGCCGCAGTGCTTG
AACATCATGACCTGGCGCGTCAGGCGCTGGAGCATCAACTGGAAGACTGCGGCCTGCAGACCATCGTGTTCAATAACCTG
GAGAACCTGCTCAACGGCGTGACCGCAGCGCACGAGACGCCAGCGGCCATCGATCTGGCGGTACTTGGCGTGACGGCGCT
GGAAATCTCTCCGGAACGGTTGCGCCAGCACATCTGGGACCTGGAAAACCTCAATTGCAAGGTCATGGTGCTGTGCCCGA
CCACCGAGCACGCGCTGTTCCAGTTGGCGGTCCACGATGTCTACACGCAACTGCAGGCCAAGCCCGCCTGCACGCGCAAA
CTGCAAAAAGCCCTGTCCGAGCTGATCGCGCCGCGAGCGGTGCGTGCCGACATCGGCCCGCCATTGTCGAGCCGTGCACC
GCGAGTGCTGTGTGTGGACGACAACCCGGCCAACCTGCTGCTGGTGCAGACCCTGCTCGAAGACATGGGCGCTGAAGTGG
TCGCTGTCGAGGGCGGCTACGCAGCGGTCAATGCCGTGCAACAGGAAGCGTTCGACCTGGTGTTGATGGACGTGCAGATG
CCCGGCATGGACGGTCGGCAGGCTACCGAGGCGATCCGCGCCTGGGAGGCCGAACGCAACCAGAGCTCGCTGCCGATCGT
GGCCCTCACCGCGCATGCGATGGCCAATGAAAAACGCTCACTGCTGCAAAGCGGTATGGACGACTACCTGACCAAGCCGA
TCAGCGAACGGCAGCTGGCGCAGGTGGTGCTCAAGTGGACCGGGCTGGCGCTGCGCAACCCTGCGCCGGAACGCCAGAAT
GAAGCGCTCGAGGTGCACGTCGGGCCGCTGGTGCTGGATCATGAAGAAGGGTTGCGCCTGGCTGCGGGCAAGGCGGATCT
CGCCGCCGACATGCTGGCCATGCTGCTGGCCTCCCTGGACGCTGACCGCGAAGCCATTCGTGTGGCGCGTGCCAACCAGG
ATGTACACGCCTTGATCGAACGCATCCACCGTCTGCACGGCGCAACGCGTTATTGCGGCGTTCCCCAGCTGCGCAGTGCC
TGCCAACGCGCCGAAACCCTGCTCAAGCAGAACGCCCCGCACACCGAAGAGGCCCTTAACGATCTGGACAAGGCCATCAT
TCGCCTGGAAGCCGAGGCGCGGGTCATGGCTTGA