Detailed information of regulator


Summary

Regulator ID REG0138 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-HK; BsaN regulon
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00077 insolico (Type i4b)
Strain Burkholderia pseudomallei K96243
Replicon chromosome
Sequence Protein sequence (246 a.a.); Nucleotide sequence (738 bp)
Description Use SOLiD RNA sequencing technology to assess T6SS-1 transcript levels in B. pseudomallei AI harboring pBHR2 and pBHR2-virAG and expression for each gene in T6SS-1 yielded significant differences in expression when compared directly between AI(pBHR2) and AI(pBHR2-virAG).
Reference

External database links

Locus tag (Gene) BPSS1494 (virG)
Coordinates (Strand) 2037977..2038714 (-)
NCBI ID 490663798
RefSeq NC_006351
Uniprot ID Q63K71_BURPS, A0A1V2D6V7_BURPE, A0A0E1VUJ5_BURPE, Q3JL63_BURP1, A3NL94_BURP6, B1H8I1_BURPE, A3P6U6_BURP0, A8EPQ3_BURPE, A0A0E1SCN6_BURPE
KEGG ID bpd:BURPS668_A2121, bps:BPSS1494, bpl:BURPS1106A_A2023, bpm:BURPS1710b_A0531
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
BPSS1495 (virA) 499518988

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Trans_reg_C PF00486.30 4.4e-20 161..235
Response_reg PF00072.26 7.4e-20 10..118

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-245 MTNATRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVLLRWRETQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRAYRFDGWTLNMNTRRLLTRDAQEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWRLRKKIEKDPKHPELIRTERGVGYYFDAKEVETLWG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8795 - -



  Protein sequence of regulator: 246 a.a.    .

>REG0138 NC_006351:c2038714-2037977 [Burkholderia pseudomallei K96243]
MTNATRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVLLRWRETQRFP
LICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRAYRFDGWTLNMNTRRLLTRDA
QEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWRLRKKIEKDPKHPELIRTERGVGYYFDAKEV
ETLWG*

  Nucleotide sequence of regulator: 738 bp    .

>REG0138 NC_006351:c2038714-2037977 [Burkholderia pseudomallei K96243]
ATGACGAATGCGACAAGATCGCCGGCGGTGCTCGTCGTCGAGGACGACGAACCGTTGCGGCGCGTGCTTTGCAATTACCT
GTCGGGCCACGGGATGGCCGTGGACGGCGTGGGAACGGCGGCAGCGGCCGCCGAATCGGTCGGGCGGCGCGAATACGAGA
TGGTGTTGCTCGATCTCGGCCTGCCGGACGGCGACGGCATCGACGTGCTGCTGCGCTGGCGCGAAACGCAGCGCTTTCCG
CTCATCTGTGTGACGGGGCGCAGCGAAGAGGCCGATCGCATCATGGGCCTCGAATTCGGCGCGGACGATTACGTCGTGAA
GCCGTACTCGCTGCGCGAGGTGCTCGCCCGGATGCGCGCGCTGTGGCGGCGCGCCGAGCCGTCGACGACGCCCGTGCGGC
GCGGCAGGCATCCGCGTGCGTACCGCTTCGACGGATGGACGCTGAACATGAACACGCGCCGGCTGTTGACGCGCGATGCG
CAGGAAATTCCGCTGACGGTCGGCGAATTCAACCTGCTCGCGTTCTTTCTCGGCTCGCCGTCGCGCGTCGTCACGCGCGC
GCAGTTGCTCGAGTGCACGCGTGCGTTCGACGACGTGTTCGATCGCGCGGTCGACGTGCAGATCTGGCGGCTGCGCAAGA
AAATCGAGAAGGATCCGAAGCATCCCGAACTGATTCGAACCGAGCGGGGCGTCGGCTACTACTTCGACGCGAAAGAGGTG
GAGACGCTATGGGGATGA