Detailed information of regulator
Summary
Regulator ID | REG0102 ![]() |
Regulator type | protein |
Regulatory pathway (from literatures) | carbon storage regulatory pathway |
KEGG pathway (determined by BlastKOALA) | Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026) |
Related T6SS | T6SS00043 ![]() ![]() |
Strain | Vibrio parahaemolyticus RIMD 2210633 |
Replicon | chromosome |
Sequence | Protein sequence (66 a.a.); Nucleotide sequence (198 bp) |
Description | Simultaneous deletion of all three CrsB ncRNA significantly increased the expression level of genes in T6SSs, indicating that CsrB negatively regulates T6SSs. Deletion of csrA dramatically reduced the expression level of T6SSs as examined by qRT‐PCR or Western blot analysis suggesting a negative regulatory cascade of T6SSs by CsrB through CrsA. |
Reference |
External database links
Target
Loading, please wait
Target | Regulation (↓/↑) | Target sequence |
---|---|---|
Hcp and vgrG expression and secretion | ↓ | - |
Showing 1 to 1 of 1 rows
Pfam domain hit(s) of regulator
Loading, please wait
Domain | Pfam ID | E-value | Aligned region |
---|---|---|---|
CsrA | PF02599.18 | 1.4e-25 | 1..52 |
Showing 1 to 1 of 1 rows
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
Loading, please wait
Prediction | Region | Sequence |
---|---|---|
Outside | 1-65 | MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYMRIQAEKGNGNVASGNY |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Loading, please wait
Prediction | Probability | Cleavage site | Signal peptide sequence |
---|---|---|---|
Other | 0.9739 | - | - |
Protein sequence of regulator: 66 a.a. .
>REG0102 NC_004603:c2688510-2688313 [Vibrio parahaemolyticus RIMD 2210633]
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYMRIQAEKGNGNVASGNY*
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYMRIQAEKGNGNVASGNY*
Nucleotide sequence of regulator: 198 bp .
>REG0102 NC_004603:c2688510-2688313 [Vibrio parahaemolyticus RIMD 2210633]
ATGCTAATTTTGACTCGCCGCGTAGGCGAAACACTTATGATTGGTGATGAAGTGACTGTAACTGTACTAGGTGTTAAAGG
TAACCAAGTACGTATCGGTGTTAACGCTCCGAAAGAGGTTTCAGTTCACCGTGAAGAAATCTACATGCGCATTCAGGCTG
AAAAAGGCAATGGCAACGTTGCTTCAGGTAACTACTAA
ATGCTAATTTTGACTCGCCGCGTAGGCGAAACACTTATGATTGGTGATGAAGTGACTGTAACTGTACTAGGTGTTAAAGG
TAACCAAGTACGTATCGGTGTTAACGCTCCGAAAGAGGTTTCAGTTCACCGTGAAGAAATCTACATGCGCATTCAGGCTG
AAAAAGGCAATGGCAACGTTGCTTCAGGTAACTACTAA