Detailed information of regulator


Summary

Regulator ID REG0102 experimental
Regulator type protein
Regulatory pathway (from literatures) carbon storage regulatory pathway
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00043 experimental (Type i1); T6SS00044 experimental (Type i5)
Strain Vibrio parahaemolyticus RIMD 2210633
Replicon chromosome
Sequence Protein sequence (66 a.a.); Nucleotide sequence (198 bp)
Description Simultaneous deletion of all three CrsB ncRNA significantly increased the expression level of genes in T6SSs, indicating that CsrB negatively regulates T6SSs. Deletion of csrA dramatically reduced the expression level of T6SSs as examined by qRT‐PCR or Western blot analysis suggesting a negative regulatory cascade of T6SSs by CsrB through CrsA.
Reference

External database links

Locus tag (Gene) VP_RS12395 (CsrA)
Coordinates (Strand) 2688313..2688510 (-)
NCBI ID 490550575
RefSeq NC_004603
Uniprot ID F9TAQ7_9VIBR, A0A1B1BSN1_9VIBR, A0A1E5FNB1_VIBSP, U2ZP46_VIBPR, A0A2I3CA03_VIBAX, U3AE26_9VIBR, CSRA_VIBCB, A0A0C1WF89_9VIBR, A0A240E9K1_9VIBR, A0A177Y0M3_9VIBR, S7I183_VIBFL, S5IWW9_VIBPH, A0A1B9QB94_9VIBR, A0A1Q9HLA1_9VIBR, A0A0T7EBJ4_9VIBR, A0A084T627_9VIBR, A0A2K1DSF5_9VIBR, A0A0H2MRT1_9VIBR, A0A1J4R2Y6_9VIBR, A0A2S7VGZ2_9VIBR, A0A0M0HWS2_9VIBR, A0A162HBM0_9VIBR, A0A2N7N4S1_9VIBR, A0A2N7IU65_9VIBR, A0A2N7IIZ6_9VIBR, A0A1R3FNC2_9VIBR, A0A1R3F060_9VIBR, A0A2K7SNZ7_9VIBR, A0A2A2NCM0_9VIBR, A0A1A6JCF8_9VIBR, A0A066URN5_9VIBR, CSRA_VIBPA, A0A0T7D595_9VIBR, A0A0Q2N2X8_VIBFU, A0A0P6YMU9_VIBSP, A0A0A5HZU5_9VIBR, A0A178JCG2_9VIBR, A3UV45_VIBS1, A0A0A5JJ10_PHOS4, A5L310_VIBBS, A0A1C3JF62_9VIBR, A0A1H6BE04_9VIBR, A0A0T7ED66_9VIBR, A0A193KEF9_9VIBR, A0A0F4NG58_9VIBR, A0A0H0YA59_VIBAL, A0A0B4IUE2_VIBHA, C9QMF4_VIBOR, A0A0X8LNQ0_VIBFL, A0A0A3EKK4_9VIBR, A0A2C9PAW7_9VIBR, A0A1B1EEU6_VIBNA, A0A0M0HLB4_VIBNE, A0A0A6QL90_9VIBR, A0A2S7VA81_9VIBR, A0A1G8BWC9_9VIBR, E8LTS3_9VIBR, E8M2L4_PHOS4, A0A090TMQ1_9VIBR, K5UN73_9VIBR
KEGG ID vha:VIBHAR_03509, vhr:AL538_06670, vpa:VP2546, vca:M892_13560, vag:N646_1640, veu:IXK98_21930, vtu:IX91_13195, vpf:M634_15155, vbr:A6E01_10775, vfl:AL536_18100
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02025; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Hcp and vgrG expression and secretion -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
CsrA PF02599.18 1.4e-25 1..52

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-65 MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYMRIQAEKGNGNVASGNY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9739 - -



  Protein sequence of regulator: 66 a.a.    .

>REG0102 NC_004603:c2688510-2688313 [Vibrio parahaemolyticus RIMD 2210633]
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYMRIQAEKGNGNVASGNY*

  Nucleotide sequence of regulator: 198 bp    .

>REG0102 NC_004603:c2688510-2688313 [Vibrio parahaemolyticus RIMD 2210633]
ATGCTAATTTTGACTCGCCGCGTAGGCGAAACACTTATGATTGGTGATGAAGTGACTGTAACTGTACTAGGTGTTAAAGG
TAACCAAGTACGTATCGGTGTTAACGCTCCGAAAGAGGTTTCAGTTCACCGTGAAGAAATCTACATGCGCATTCAGGCTG
AAAAAGGCAATGGCAACGTTGCTTCAGGTAACTACTAA