Detailed information of regulator


Summary

Regulator ID REG0101 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00043 experimental (Type i1); T6SS00044 experimental (Type i5)
Strain Vibrio parahaemolyticus RIMD 2210633
Replicon chromosome
Sequence Protein sequence (215 a.a.); Nucleotide sequence (645 bp)
Description A ChIP‐qPCR confirmed by examination of the selected candidates from ChIP‐Seq that UvrY at least binds to the promoter regions of three ncRNA (CsrB1, CsrB2, and CsrB3),and the gene of potential T6SS1 regulator VP1407.Deletion of uvrY significantly reduced CsrB expression level in vitro when bacteria were cultured in LB medium at 23℃, suggesting that UvrY positively control CrsBs in vitro. Western blot analysis showed that the expression and secretion of effectors from 34 T6SS1 (Hcp1), and T6SS2 (Hcp2)75 were significantly decreased in ΔuvrY, and these defects were fully recovered by a complementation of ΔuvrY with WT copy of uvrY.
Reference

External database links

Locus tag (Gene) VP_RS09470 (UvrY)
Coordinates (Strand) 2037468..2038112 (-)
NCBI ID 491529158
RefSeq NC_004603
Uniprot ID S5IWM2_VIBPH, Q87NC3_VIBPA, A0A0T7E7L8_9VIBR, A0A0G9M1V6_VIBAL, D0WZF4_VIBAL
KEGG ID vpa:VP1945, vpf:M634_11955
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02025; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
CsrB -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 3.7e-31 4..116
GerE PF00196.21 4.8e-18 149..203

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-214 MINVFLVDDHELVRTGIRRIIEDVRGMNVAGEADSGEDAVKWCRSNHADVVLMDMNMPGIGGLEATKKILRVNPDVKIIVLTVHTENPFPTKVMQAGASGYLTKGAGPDEMVNAIRVVNSGQRYISPEIAQQMALSQFSPASENPFKDLSERELQIMLMITKGQKVTDISEQLNLSPKTVNSYRYRLFSKLDINGDVELTHLAIRHGMLDTETL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9929 - -



  Protein sequence of regulator: 215 a.a.    .

>REG0101 NC_004603:c2038112-2037468 [Vibrio parahaemolyticus RIMD 2210633]
MINVFLVDDHELVRTGIRRIIEDVRGMNVAGEADSGEDAVKWCRSNHADVVLMDMNMPGIGGLEATKKILRVNPDVKIIV
LTVHTENPFPTKVMQAGASGYLTKGAGPDEMVNAIRVVNSGQRYISPEIAQQMALSQFSPASENPFKDLSERELQIMLMI
TKGQKVTDISEQLNLSPKTVNSYRYRLFSKLDINGDVELTHLAIRHGMLDTETL*

  Nucleotide sequence of regulator: 645 bp    .

>REG0101 NC_004603:c2038112-2037468 [Vibrio parahaemolyticus RIMD 2210633]
TTGATTAATGTTTTCCTTGTAGATGATCACGAGCTGGTTCGCACAGGGATACGACGTATTATTGAAGACGTCCGTGGAAT
GAACGTAGCAGGAGAAGCTGACAGCGGTGAAGATGCAGTTAAATGGTGTCGCAGTAATCATGCTGACGTCGTTTTAATGG
ACATGAACATGCCTGGGATTGGCGGCTTGGAAGCCACCAAGAAAATTCTTCGCGTGAATCCAGATGTGAAAATCATCGTA
CTAACCGTTCATACGGAAAATCCGTTTCCAACCAAAGTGATGCAGGCTGGTGCTTCTGGTTATTTAACCAAAGGTGCAGG
GCCGGATGAAATGGTAAATGCAATTCGTGTGGTCAATAGTGGGCAGCGTTACATCTCTCCAGAGATAGCGCAGCAAATGG
CATTGAGCCAGTTCTCACCAGCCTCTGAAAACCCATTTAAAGATTTGTCCGAACGTGAACTGCAAATCATGCTTATGATC
ACGAAAGGTCAGAAAGTAACGGATATTTCTGAGCAACTTAACTTAAGTCCAAAGACAGTCAACAGCTACCGCTATCGACT
GTTTAGCAAGCTGGACATTAATGGTGACGTCGAGTTAACACACTTAGCGATTCGCCACGGAATGCTGGACACCGAGACCC
TTTAG