Detailed information of regulator


Summary

Regulator ID REG0089 experimental
Regulator type protein
Regulatory pathway (from literatures) Unknown
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00028 insolico (Type i3)
Strain Xanthomonas citri pv. citri str. 306
Replicon chromosome
Sequence Protein sequence (176 a.a.); Nucleotide sequence (528 bp)
Description EcfK/RpoE are required and essential for T6SS-dependent resistance to Dictyostelium predation,and EcfK acts downstream of PknS.
Reference

External database links

Locus tag (Gene) xac4129 (ecfK/RpoE,ECF σ factor)
Coordinates (Strand) 4850278..4850805 (+)
NCBI ID 489582896
RefSeq NC_003919
Uniprot ID A0A1T1NQ25_9XANT, A0A221LVT4_XANCM, H8FHB2_XANCI, Q8PF56_XANAC
KEGG ID xac:XAC4129
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Sigma70_r4_2 PF08281.14 3.1e-16 111..163
Sigma70_r2 PF04542.16 1.8e-11 12..78

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-175 VSAHPKRAWARLFTEHGPVLRGFFVRRGANEDAEDLVQETYLRLLRAHQQPGQAIANPEAYLYTVAVNLAREQAARRRQAPLRIEDMEQFAQRLVAGDDVEDSAQRQQRQQRLQTVLAGLPERVRAVLVMQYRDGLSYKQIAERLGVSSHMVKKYVVRGLSACRSALADEGAQWW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9941 - -



  Protein sequence of regulator: 176 a.a.    .

>REG0089 NC_003919:4850278-4850805 [Xanthomonas citri pv. citri str. 306]
VSAHPKRAWARLFTEHGPVLRGFFVRRGANEDAEDLVQETYLRLLRAHQQPGQAIANPEAYLYTVAVNLAREQAARRRQA
PLRIEDMEQFAQRLVAGDDVEDSAQRQQRQQRLQTVLAGLPERVRAVLVMQYRDGLSYKQIAERLGVSSHMVKKYVVRGL
SACRSALADEGAQWW*

  Nucleotide sequence of regulator: 528 bp    .

>REG0089 NC_003919:4850278-4850805 [Xanthomonas citri pv. citri str. 306]
GTGTCGGCACATCCAAAGCGCGCCTGGGCACGTCTGTTCACCGAGCATGGCCCGGTGCTGCGCGGCTTCTTCGTGCGCCG
CGGAGCAAACGAGGACGCCGAAGACCTGGTCCAGGAAACCTATCTGCGCCTGCTGCGTGCGCATCAGCAGCCGGGCCAGG
CCATCGCCAACCCGGAAGCGTATCTCTATACCGTGGCGGTCAATCTGGCGCGCGAGCAGGCGGCGCGGCGCAGGCAGGCC
CCGCTGCGCATCGAGGACATGGAACAGTTCGCCCAACGGCTGGTGGCCGGTGACGATGTCGAAGACAGCGCCCAGCGGCA
ACAGCGCCAGCAACGGCTGCAGACCGTACTGGCCGGGCTGCCCGAGCGCGTGCGTGCGGTGCTGGTGATGCAGTACCGCG
ACGGCCTGAGCTACAAACAGATCGCCGAACGTCTGGGTGTGTCCTCGCACATGGTCAAGAAATACGTGGTGCGCGGCCTG
TCGGCCTGTCGATCGGCGCTGGCCGACGAGGGAGCGCAGTGGTGGTGA