Detailed information of regulator


Summary

Regulator ID REG0077 experimental
Regulator type protein
Regulatory pathway (from literatures) Tpp
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00016 experimental (Type i5)
Strain Agrobacterium fabrum str. C58
Replicon chromosome
Sequence Protein sequence (400 a.a.); Nucleotide sequence (1200 bp)
Description Hcp secretion was completely abolished in FhaΔFHA and FhaR30AS46A strains.
Reference

External database links

Locus tag (Gene) Atu4335 (Fha/TagH)
Coordinates (Strand) 1467064..1468263 (-)
NCBI ID 499280697
RefSeq NC_003063
Uniprot ID A0A083ZIC2_RHIRD, A9CGG1_AGRFC
KEGG ID atu:Atu4335
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
FHA PF00498.28 2e-15 28..93

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-399 MKLALKNTRNIGTGKAGQWSFERGRRAIGRSRDCDWQIDDNERRVSKLHCTLSRDGEGFIILDQSANGTLVDGRLLLEGESARLRDGSQINIGGQIFEVAISGNAELDFSDPDASLKMSDETLTISAILADIAPNGRSAGGLLGNTAAADDWPETRRESAGRKAKSISRNVEIGWSEPPSAQGIGTVLPDDWDTEPAASSDHEHTDALNTPVMISRPVSASHDRDFDSVFPDTDEDPIRQGRLPADTATAQEIGDLLTALERESADCLAILDIESDHAGQGPAPSLSERMETLIGQQRRLAASLETLMHGCTQKLEPRLLEAAVDAGNDFRAKIGRRDWQGLVMKTDYWSAYKKQFEENGRPLPVRQFLQRAARGEAASARETDATAADAKGVNNHDET



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9579 - -



  Protein sequence of regulator: 400 a.a.    .

>REG0077 NC_003063:c1468263-1467064 [Agrobacterium fabrum str. C58]
MKLALKNTRNIGTGKAGQWSFERGRRAIGRSRDCDWQIDDNERRVSKLHCTLSRDGEGFIILDQSANGTLVDGRLLLEGE
SARLRDGSQINIGGQIFEVAISGNAELDFSDPDASLKMSDETLTISAILADIAPNGRSAGGLLGNTAAADDWPETRRESA
GRKAKSISRNVEIGWSEPPSAQGIGTVLPDDWDTEPAASSDHEHTDALNTPVMISRPVSASHDRDFDSVFPDTDEDPIRQ
GRLPADTATAQEIGDLLTALERESADCLAILDIESDHAGQGPAPSLSERMETLIGQQRRLAASLETLMHGCTQKLEPRLL
EAAVDAGNDFRAKIGRRDWQGLVMKTDYWSAYKKQFEENGRPLPVRQFLQRAARGEAASARETDATAADAKGVNNHDET*

  Nucleotide sequence of regulator: 1200 bp    .

>REG0077 NC_003063:c1468263-1467064 [Agrobacterium fabrum str. C58]
ATGAAGCTTGCACTCAAGAACACACGGAACATCGGGACGGGAAAAGCCGGCCAGTGGAGCTTCGAGCGAGGCCGCCGCGC
AATTGGCCGGTCTCGTGATTGCGACTGGCAGATCGATGACAATGAGCGGCGCGTTTCCAAGCTGCATTGCACGCTGAGCC
GCGACGGCGAAGGTTTCATCATCCTCGACCAGAGCGCAAACGGCACGCTCGTCGATGGCCGTCTGTTGCTTGAGGGCGAA
AGCGCGCGTCTTCGGGACGGTTCGCAGATCAATATCGGCGGGCAGATTTTCGAGGTCGCCATCAGCGGCAATGCGGAGCT
CGATTTTTCCGATCCCGACGCCTCGCTGAAGATGAGTGACGAGACGCTGACCATTTCGGCGATCCTTGCCGATATCGCCC
CGAACGGCCGTTCTGCCGGCGGCCTGCTGGGCAACACCGCCGCCGCCGATGACTGGCCGGAAACACGGCGCGAAAGCGCG
GGCCGGAAGGCGAAGTCCATTTCGCGCAACGTCGAGATCGGCTGGAGCGAACCGCCCTCTGCGCAGGGAATTGGCACTGT
TCTGCCTGATGACTGGGATACGGAGCCGGCTGCAAGCAGCGACCACGAACATACCGATGCGCTGAACACGCCGGTCATGA
TCTCACGTCCGGTCTCGGCTTCGCATGACCGGGATTTTGACAGCGTTTTCCCGGATACAGACGAAGACCCGATCCGCCAG
GGCAGATTGCCCGCGGACACGGCGACCGCACAGGAGATCGGCGATCTTCTGACGGCACTGGAAAGGGAAAGTGCCGATTG
CCTGGCCATCCTCGACATTGAGAGCGATCATGCCGGCCAAGGCCCGGCACCATCCCTCAGCGAGCGAATGGAAACGCTCA
TTGGCCAGCAGCGCCGTCTTGCCGCCTCGCTCGAAACCCTCATGCATGGCTGCACGCAGAAACTCGAGCCCCGGCTTCTT
GAGGCCGCTGTCGATGCCGGCAACGATTTTCGCGCGAAGATCGGGCGCAGAGACTGGCAGGGGCTGGTCATGAAGACCGA
CTACTGGTCGGCTTACAAAAAACAATTCGAAGAAAACGGCCGTCCATTGCCGGTCAGGCAGTTCCTGCAGCGGGCAGCGC
GTGGTGAAGCCGCGTCCGCACGGGAGACTGACGCGACCGCGGCCGATGCCAAGGGGGTAAACAACCACGATGAGACATGA