Detailed information of regulator


Summary

Regulator ID REG0036 experimental
Regulator type protein
Regulatory pathway (from literatures) Unknown
KEGG pathway (determined by BlastKOALA) Cell cycle - Caulobacter (map04112)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (787 a.a.); Nucleotide sequence (2361 bp)
Description LonA affects the transcription, production, and activity of the T6SS.
Reference

External database links

Locus tag (Gene) VC1920/VCA1552_01695 (LonA)
Coordinates (Strand) 1845472..1847832 (-)
NCBI ID 446970355
RefSeq NZ_CP024867
Uniprot ID A0A085QFL8_VIBCL, A0A0H3AH46_VIBC3, A0A0H3Q351_VIBCL, A0A0K9V162_VIBCL, A0A0X1KXN9_VIBCO, C3LNM4_VIBCM, Q9KQS8_VIBCH
KEGG ID vcm:VCM66_1844, vco:VC0395_A1510, vcx:VAA049_955, vcz:VAB027_2564, vcq:EN18_12720, vch:VC1920
KEGG pathway (determined by BlastKOALA) map04112
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Lon_C PF05362.15 1.1e-99 569..771
LON_substr_bdg PF02190.18 1.2e-40 10..196
AAA PF00004.31 1.3e-17 351..488

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-786 MNLERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIQCLEAAMDNNKQVLLVAQKKAETDEPKVADLFEVGTVATILQLLKLPDGTVKVLVEGQQRAKITQFYEEEYFFADAQYLVTPELDEREQEVVVRSAINQFEGFIKLNKKIPPEVLTSLNGIDEAARLADTIAAHMPLKLVDKQKVLELLDVSERLEFLMGQMESEIDLLQVEKRIRTRVKKQMEKSQREYYLNEQMKAIQKELGEMDDAPDEFETLKKKIEESKMPKEARDKAEQELHKLKMMSPMSAEATVVRSYIDWMVNVPWTKRSKVKKDLSKAEEILNADHYGLERVKERILEYLAVQSRINKLKGPILCLVGPPGVGKTSLGRSIAAATGRQYVRMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNNSFNDHYLEVDYDLSDVMFVATSNSMNIPGPLLDRMEVIRLSGYTEDEKLNIAKDHLVSKQVERNGLKPSEIVIEDSAIVGIIRYYTREAGVRGLEREISKICRKAVKKILLDKGVKTVVVNQQNLKEFLGVQRFDYGKAEESNRIGQVNGLAWTEVGGDLLTIETQSMPGKGKLTQTGSLGDVMQESIQAAMTVVRSRAEKLGINPDFYEKKDIHVHVPEGATPKDGPSAGIAMCTALVSSLTGNPVKAEVAMTGEITLRGEVLPIGGLKEKLLAAHRGGIKTVLIPKDNERDLEEIPDNVIADLQVLPVQWIDEVLKVALEQDPTGVSFESKKSDA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9931 - -



  Protein sequence of regulator: 787 a.a.    .

>REG0036 NZ_CP024867:c1847832-1845472 [Vibrio cholerae]
MNLERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIQCLEAAMDNNKQVLLVAQKKAETDEPKVADLFEVGTVATILQL
LKLPDGTVKVLVEGQQRAKITQFYEEEYFFADAQYLVTPELDEREQEVVVRSAINQFEGFIKLNKKIPPEVLTSLNGIDE
AARLADTIAAHMPLKLVDKQKVLELLDVSERLEFLMGQMESEIDLLQVEKRIRTRVKKQMEKSQREYYLNEQMKAIQKEL
GEMDDAPDEFETLKKKIEESKMPKEARDKAEQELHKLKMMSPMSAEATVVRSYIDWMVNVPWTKRSKVKKDLSKAEEILN
ADHYGLERVKERILEYLAVQSRINKLKGPILCLVGPPGVGKTSLGRSIAAATGRQYVRMALGGVRDEAEIRGHRRTYIGS
MPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNNSFNDHYLEVDYDLSDVMFVATSNSMNIPGPL
LDRMEVIRLSGYTEDEKLNIAKDHLVSKQVERNGLKPSEIVIEDSAIVGIIRYYTREAGVRGLEREISKICRKAVKKILL
DKGVKTVVVNQQNLKEFLGVQRFDYGKAEESNRIGQVNGLAWTEVGGDLLTIETQSMPGKGKLTQTGSLGDVMQESIQAA
MTVVRSRAEKLGINPDFYEKKDIHVHVPEGATPKDGPSAGIAMCTALVSSLTGNPVKAEVAMTGEITLRGEVLPIGGLKE
KLLAAHRGGIKTVLIPKDNERDLEEIPDNVIADLQVLPVQWIDEVLKVALEQDPTGVSFESKKSDA*

  Nucleotide sequence of regulator: 2361 bp    .

>REG0036 NZ_CP024867:c1847832-1845472 [Vibrio cholerae]
ATGAACTTGGAGCGTTCCGAGCGTATCGAGATCCCCGTACTACCCCTGCGCGACGTGGTTGTCTATCCACACATGGTCAT
TCCTTTGTTTGTTGGCCGAGAAAAATCGATCCAGTGCCTAGAAGCGGCGATGGATAACAACAAGCAAGTGTTATTGGTGG
CGCAAAAGAAAGCGGAAACCGATGAGCCGAAAGTCGCCGACTTATTTGAAGTCGGTACCGTCGCAACCATCTTACAGTTG
CTGAAATTGCCTGATGGCACAGTGAAAGTACTGGTCGAAGGTCAACAGCGTGCCAAAATCACTCAATTCTATGAAGAAGA
GTATTTCTTTGCCGATGCACAATATCTGGTGACACCAGAATTGGATGAGCGTGAGCAAGAAGTGGTGGTTCGCAGTGCGA
TTAACCAGTTTGAAGGCTTTATCAAACTCAACAAAAAAATCCCGCCTGAGGTACTCACTTCACTGAACGGGATTGATGAG
GCCGCACGTTTAGCAGACACGATTGCCGCGCACATGCCGCTGAAATTGGTCGATAAACAGAAAGTGCTTGAACTGCTGGA
TGTCAGTGAACGTTTAGAATTCTTAATGGGGCAGATGGAGTCTGAAATCGATCTGCTGCAGGTTGAGAAGCGCATCCGCA
CCCGCGTTAAAAAGCAGATGGAAAAGTCACAGCGCGAGTACTATCTGAATGAACAGATGAAAGCGATTCAGAAAGAATTA
GGCGAGATGGATGACGCGCCTGACGAATTTGAAACGCTGAAAAAGAAAATCGAAGAGTCGAAGATGCCGAAAGAGGCACG
CGACAAAGCAGAGCAAGAGCTGCACAAGCTGAAAATGATGTCGCCGATGTCAGCAGAAGCAACGGTAGTGCGTAGCTACA
TCGATTGGATGGTCAATGTTCCGTGGACTAAGCGCAGCAAGGTGAAAAAAGATCTCTCTAAAGCAGAAGAGATCCTCAAT
GCTGACCACTACGGCTTAGAGCGGGTCAAAGAGCGTATTTTGGAATATCTCGCCGTGCAAAGTCGTATCAATAAGCTTAA
AGGTCCAATCCTATGCTTAGTGGGGCCTCCGGGTGTGGGTAAAACCTCACTGGGTCGCTCGATTGCCGCTGCGACTGGGC
GTCAGTATGTGCGTATGGCGCTGGGGGGCGTGCGTGATGAAGCGGAAATTCGTGGTCACCGCCGCACCTACATTGGCTCT
ATGCCGGGTAAGCTTATTCAAAAGATGGCGAAAGTCGGGGTGAAAAACCCACTCTTCTTACTCGATGAAATCGACAAGAT
GTCATCGGATATGCGTGGTGATCCGGCTTCTGCACTGCTAGAGGTGCTTGACCCTGAGCAAAACAACTCGTTTAACGATC
ACTACCTAGAAGTGGATTATGACCTGTCGGACGTGATGTTCGTTGCGACTTCAAACTCGATGAACATTCCAGGCCCATTA
CTAGACCGTATGGAAGTGATTCGTTTATCGGGGTACACCGAAGATGAAAAACTCAATATTGCCAAAGACCATCTGGTCAG
TAAGCAAGTTGAGCGTAACGGCCTCAAGCCAAGCGAGATCGTGATTGAAGATTCTGCGATTGTCGGCATTATTCGCTATT
ACACTCGTGAAGCGGGCGTGCGTGGTCTGGAGCGCGAAATCTCAAAGATCTGTCGTAAAGCCGTGAAGAAAATTCTGCTC
GATAAAGGCGTGAAAACCGTTGTTGTAAACCAACAAAACTTAAAAGAGTTTTTAGGTGTACAACGCTTTGACTACGGTAA
AGCGGAAGAGAGCAACCGTATTGGTCAAGTGAATGGCCTCGCGTGGACGGAAGTGGGCGGTGATTTACTAACCATCGAAA
CCCAATCGATGCCGGGTAAAGGTAAACTTACCCAAACCGGTTCACTGGGCGATGTGATGCAAGAGTCGATTCAAGCGGCG
ATGACGGTGGTGCGCTCTCGTGCAGAAAAATTGGGCATCAACCCTGATTTCTATGAGAAAAAAGATATCCATGTCCATGT
CCCAGAAGGTGCGACACCTAAAGATGGCCCAAGTGCGGGTATCGCCATGTGTACAGCGCTGGTTTCTAGTTTGACCGGTA
ACCCAGTCAAAGCGGAAGTCGCCATGACCGGTGAAATCACTCTGCGTGGTGAAGTATTACCGATTGGTGGTTTGAAAGAG
AAACTGCTGGCAGCACATCGCGGTGGCATCAAAACGGTGCTGATCCCGAAAGATAATGAGCGCGATCTGGAGGAGATCCC
AGATAACGTGATCGCCGATCTGCAAGTACTTCCAGTGCAGTGGATTGACGAGGTGCTCAAAGTTGCCTTGGAGCAAGACC
CGACAGGGGTTAGCTTTGAGAGCAAAAAGAGTGATGCATAG