Detailed information of regulator


Summary

Regulator ID REG0021 experimental
Regulator type protein
Regulatory pathway (from literatures) Unknown
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS01168 experimental (Type i1)
Strain Vibrio cholerae C6706
Replicon chromosome
Sequence Protein sequence (336 a.a.); Nucleotide sequence (1008 bp)
Description CytR is a Global regulator in Vibrio cholerae and is required for bacterial killing via the Type VI secretion system and mediated solely via QstR-upregulation.
Reference

External database links

Locus tag (Gene) GPY04_RS11195 (CytR)
Coordinates (Strand) 2449479..2450486 (-)
NCBI ID 446146597
RefSeq NZ_CP046844
Uniprot ID A0A085RG68_VIBCL, A0A0H3AJ95_VIBC3, A0A0H3Q7N4_VIBCL, A0A0K9UP89_VIBCL, A0A0X1L485_VIBCO, A0A1D8S819_VIBMI, C3LSA6_VIBCM, D7HFV5_VIBCL, Q9KNQ4_VIBCH
KEGG ID vcm:VCM66_2597, vch:VC2677, vco:VC0395_A2250, vmi:AL543_08230, vcq:EN18_16390
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Peripla_BP_3 PF13377.8 1.9e-43 168..328
LacI PF00356.23 5e-20 3..48

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-335 MATMKDVAQLAGVSTATVSRALMNPEKVSSSTRKRVEEAVLEAGYSPNSLARNLRRNESKTIVAIVPDICDPYFSEIIRGIEDAAMEHGYLVLLGDSGQQKRRENSFVNLVFTKQADGMLLLGTDLPFDVSKPEQKNLPPMVMACEFAPELELPTVHIDNLTSAFEAVNYLTQLGHKRIAQISGPQHAALCQFRHQGYQQALRRAGITMNPTYCTFGDFTFEAGAKAVRQLLALPEQPTAIFCHNDTMAIGAIQEAKRLGLRVPQDLSVVGFDDIQFAQYCDPPLTTISQPRYEIGRQAMLMMLELLRGHDVRAGSRLLETKLVVRESAAPPSKK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8850 - -



  Protein sequence of regulator: 336 a.a.    .

>REG0021 NZ_CP046844:c2450486-2449479 [Vibrio cholerae C6706]
MATMKDVAQLAGVSTATVSRALMNPEKVSSSTRKRVEEAVLEAGYSPNSLARNLRRNESKTIVAIVPDICDPYFSEIIRG
IEDAAMEHGYLVLLGDSGQQKRRENSFVNLVFTKQADGMLLLGTDLPFDVSKPEQKNLPPMVMACEFAPELELPTVHIDN
LTSAFEAVNYLTQLGHKRIAQISGPQHAALCQFRHQGYQQALRRAGITMNPTYCTFGDFTFEAGAKAVRQLLALPEQPTA
IFCHNDTMAIGAIQEAKRLGLRVPQDLSVVGFDDIQFAQYCDPPLTTISQPRYEIGRQAMLMMLELLRGHDVRAGSRLLE
TKLVVRESAAPPSKK*

  Nucleotide sequence of regulator: 1008 bp    .

>REG0021 NZ_CP046844:c2450486-2449479 [Vibrio cholerae C6706]
ATGGCGACAATGAAGGATGTTGCCCAGCTTGCTGGAGTTTCAACCGCGACCGTGTCTCGTGCGTTGATGAATCCAGAGAA
AGTCTCGTCGTCCACTCGTAAACGAGTGGAAGAGGCCGTGCTGGAAGCGGGTTACTCACCCAATTCTTTGGCGCGCAATT
TGCGCCGTAATGAATCGAAAACCATCGTTGCTATCGTGCCAGATATCTGTGATCCCTACTTTTCTGAGATCATTCGCGGT
ATTGAAGATGCCGCGATGGAGCACGGTTATCTGGTGCTGTTGGGGGATAGTGGTCAACAGAAGCGTCGGGAGAACTCGTT
CGTTAATCTGGTGTTTACCAAACAGGCAGACGGTATGTTGCTGCTGGGGACAGATTTGCCGTTTGATGTGAGTAAACCTG
AGCAGAAAAACCTACCGCCTATGGTGATGGCGTGTGAATTTGCGCCAGAGCTGGAATTGCCAACGGTACACATTGATAAC
CTGACCTCGGCATTTGAGGCGGTAAACTATCTCACTCAGCTTGGGCACAAACGGATTGCGCAGATCTCAGGTCCACAACA
TGCTGCGCTGTGCCAATTCCGTCATCAAGGCTATCAACAGGCGTTGCGTCGTGCTGGCATCACCATGAACCCGACTTACT
GCACTTTTGGCGATTTCACTTTTGAAGCCGGGGCAAAAGCGGTGCGTCAGCTGTTGGCATTGCCTGAGCAGCCGACCGCG
ATTTTCTGTCATAACGATACGATGGCGATTGGCGCAATTCAGGAAGCGAAGCGACTTGGCTTGCGCGTACCGCAAGATCT
CTCTGTGGTCGGTTTTGACGATATTCAGTTTGCCCAGTACTGCGATCCCCCATTAACCACCATTTCGCAGCCGCGTTATG
AGATTGGCCGTCAAGCCATGCTGATGATGCTTGAGCTGCTTCGCGGACACGATGTACGTGCTGGATCGCGTCTTTTGGAG
ACCAAGCTGGTCGTGCGTGAGAGTGCTGCGCCGCCAAGCAAGAAGTAA