Detailed information of regulator


Summary

Regulator ID REG0013 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Biosynthesis of secondary metabolites (map01110); Inositol phosphate metabolism (map00562); Streptomycin biosynthesis (map00521); Phosphatidylinositol signaling system (map04070)
Related T6SS T6SS01211 experimental (Type i1); T6SS01212 experimental (Type i4a); T6SS01213 experimental (Type i3)
Strain Pseudomonas aeruginosa PAK
Replicon chromosome
Sequence Protein sequence (272 a.a.); Nucleotide sequence (816 bp)
Description SuhB regulates the expression of RsmY/Z through GacA and regulates the expression of Hcp1 through GacA and RsmY/Z, similar to their effect on the T3SS.
Reference

External database links

Locus tag (Gene) Y880_03649 (suhB)
Coordinates (Strand) 3616623..3617438 (+)
NCBI ID 489183406
RefSeq NZ_CP020659
Uniprot ID V6A9X5_PSEAI, A0A1C7BM28_PSEAI, A0A0H2ZE36_PSEAB, SUHB_PSEAE
KEGG ID pae:PA3818, pau:PA14_14680
KEGG pathway (determined by BlastKOALA) map01100; map01110; map00562; map00521; map04070
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Y880_02189 (gacA/uvrY) -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Inositol_P PF00459.27 1.3e-65 1..258

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-271 MQPMLNIALRAARSAGELIFRSIERLDVISVNEKDAKDYVTEVDRAAEQTIVAALRKAYPTHAIMGEEGGFIEGSGEGADYLWVIDPLDGTTNFIHGVPHFAVSIACKYKGRLEHAVVLDPVRQEEFTASRGRGAALNGRRLRVSGRKSLEGALLGTGFPFRDNQIDNLDNYLNMFRSLVGQTAGIRRAGAASLDLAYVAAGRYDAFWEFGLSEWDMAAGALLVQEAGGLVSDFTGSHEFLEKGHIVAGNTKCFKALLTTIQPHLPPSLKR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9683 - -



  Protein sequence of regulator: 272 a.a.    .

>REG0013 NZ_CP020659:3616623-3617438 [Pseudomonas aeruginosa PAK]
MQPMLNIALRAARSAGELIFRSIERLDVISVNEKDAKDYVTEVDRAAEQTIVAALRKAYPTHAIMGEEGGFIEGSGEGAD
YLWVIDPLDGTTNFIHGVPHFAVSIACKYKGRLEHAVVLDPVRQEEFTASRGRGAALNGRRLRVSGRKSLEGALLGTGFP
FRDNQIDNLDNYLNMFRSLVGQTAGIRRAGAASLDLAYVAAGRYDAFWEFGLSEWDMAAGALLVQEAGGLVSDFTGSHEF
LEKGHIVAGNTKCFKALLTTIQPHLPPSLKR*

  Nucleotide sequence of regulator: 816 bp    .

>REG0013 NZ_CP020659:3616623-3617438 [Pseudomonas aeruginosa PAK]
ATGCAGCCTATGCTGAATATCGCCCTGCGCGCCGCTCGCAGCGCCGGTGAACTGATTTTCCGCTCCATCGAACGCCTGGA
TGTCATCTCGGTCAACGAGAAGGATGCCAAGGACTACGTGACCGAAGTCGATCGCGCCGCCGAGCAGACCATCGTCGCCG
CGCTGCGCAAGGCCTATCCGACTCACGCGATCATGGGCGAGGAAGGCGGCTTCATCGAAGGCAGCGGCGAGGGTGCCGAT
TACCTCTGGGTGATCGATCCGCTGGACGGCACCACCAACTTCATCCATGGCGTACCGCACTTCGCCGTGAGCATCGCCTG
CAAGTACAAAGGCCGCCTGGAGCACGCCGTGGTCCTCGACCCGGTACGCCAGGAAGAATTCACCGCCAGCCGCGGTCGCG
GCGCCGCCCTCAACGGTCGCCGCCTGCGCGTCAGCGGCCGCAAGAGCCTGGAAGGCGCCCTGCTCGGCACCGGGTTCCCG
TTCCGCGACAACCAGATCGACAATCTCGACAACTACCTGAACATGTTCCGCAGCCTGGTCGGCCAGACCGCCGGCATCCG
CCGCGCCGGCGCCGCCAGCCTGGACCTGGCCTACGTCGCCGCCGGACGCTACGACGCCTTCTGGGAATTCGGCCTGTCCG
AATGGGACATGGCGGCAGGCGCCCTGCTGGTACAGGAAGCCGGCGGCCTGGTGAGCGACTTCACCGGCAGCCACGAATTC
CTCGAGAAGGGTCACATCGTCGCCGGCAACACCAAATGCTTCAAGGCACTGCTGACCACCATCCAGCCGCACCTGCCGCC
GTCGCTGAAGCGCTGA