Detailed information of regulator


Summary

Regulator ID REG0011 experimental
Regulator type protein
Regulatory pathway (from literatures) RsmA regulatory pathway
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS01211 experimental (Type i1); T6SS01212 experimental (Type i4a); T6SS01213 experimental (Type i3)
Strain Pseudomonas aeruginosa PAK
Replicon chromosome
Sequence Protein sequence (72 a.a.); Nucleotide sequence (216 bp)
Description Compared with wild-type PA103, PtssA1-lacZ transcriptional and translational reporter activity remained unaffected in the rsmF mutant, but was slightly derepressed in the rsmA mutant and significantly derepressed in an rsmAF mutant. Complementation of the rsmAF mutant with either plasmid-encoded RsmA or RsmF restored repression of PtssA1-lacZ and PtssA1’-‘lacZ reporter activities.
Reference

External database links

Locus tag (Gene) Y880_05180 (rmsF)
Coordinates (Strand) 5147809..5148024 (-)
NCBI ID 489186811
RefSeq NZ_CP020659
Uniprot ID S5ZIQ4_PSEA1, V6ANM7_PSEAI, A0A1C7BD30_PSEAI, A0A0H2ZIZ8_PSEAB
KEGG ID pau:PA14_68470
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02025; map02026
PDB ID 4K59, 4KJI, 4KRW

  Target
Target Regulation (↓/↑) Target sequence
tssA1 expression -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
CsrA PF02599.18 2.1e-10 4..67

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-71 MGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9900 - -



  Protein sequence of regulator: 72 a.a.    .

>REG0011 NZ_CP020659:c5148024-5147809 [Pseudomonas aeruginosa PAK]
MGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG*

  Nucleotide sequence of regulator: 216 bp    .

>REG0011 NZ_CP020659:c5148024-5147809 [Pseudomonas aeruginosa PAK]
ATGGGTTTCCTGATACTCTCCCGCCGAGAAGGCGAAGGCATCACCCTGTCCCTCAAGGCCGACTACCCGGCGGAGGAACT
GATTCGGCAATTGCGCGAAGGCGGCATCCGGATCCTGGTCACCGATATCATCGGCAACCAGGCCCGGGTCGGGATCGAGG
CGCCGCGTGGTGTCCTGATCGTTCGCGACGAGTTGAAAACGGCACCGAAAGGCTGA