Detailed information of immunity protein


Summary

Immunity protein ID IMU38215 experimental
Cognate effector EFF76642 experimental
Related T6SS (Type) T6SS01213 experimental (Type i3)
Strain Pseudomonas aeruginosa PAK
Replicon chromosome
Sequence Protein sequence (109 a.a.); Nucleotide sequence (327 bp)
Description The PAKΔretS strain lacking either tsei8 or tse8 could be complemented in a competition assay by expression of tsei8 from pBBR-MCS5 or tse8 from pBBR-MCS4.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Y880_RS19075 (tsi8)
Coordinates (Strand) 3988145..3988471 (+)
NCBI ID WP_003093540.1
RefSeq NZ_CP020659
Uniprot ID A0A081HJU1_PSEAI, A0A0H2ZG99_PSEAB, A0A1F0IAB1_9PSED, A0A3S4Q300_PSEFL, V6A9X8_PSEAI
KEGG ID pau:PA14_10020
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GGACT PF06094.14 1.9e-15 4..106

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-108 MQRLFVYGSLGPGRPNEHLMQKIGGQWQAASLRGRLLEKGWGAGMGFPGLAIDADGEEIHGHVFVSDRLAEHWPALDEFEGTEYRRVATRVTLADGAQVDAYVYALRD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9652 - -



  Protein sequence: 109 a.a.    .

>IMU38215 NZ_CP020659:3988145-3988471 [Pseudomonas aeruginosa PAK]
MQRLFVYGSLGPGRPNEHLMQKIGGQWQAASLRGRLLEKGWGAGMGFPGLAIDADGEEIHGHVFVSDRLAEHWPALDEFE
GTEYRRVATRVTLADGAQVDAYVYALRD*

  Nucleotide sequence: 327 bp    .

>IMU38215 NZ_CP020659:3988145-3988471 [Pseudomonas aeruginosa PAK]
ATGCAGCGACTCTTCGTCTACGGCAGCCTCGGCCCCGGCCGTCCCAACGAACACCTGATGCAGAAGATCGGCGGGCAATG
GCAGGCGGCCAGCCTCCGCGGTCGCCTGCTGGAAAAGGGCTGGGGTGCCGGGATGGGCTTTCCGGGCCTGGCGATCGACG
CCGACGGCGAGGAAATCCACGGCCATGTGTTCGTCTCCGACCGCCTCGCCGAGCACTGGCCCGCGCTGGATGAATTCGAA
GGCACCGAATACCGGCGCGTGGCGACCCGGGTAACGCTGGCCGACGGCGCCCAGGTCGATGCCTACGTCTACGCCCTGCG
CGACTGA