Detailed information of effector


Summary

Effector ID EFF76642 experimental
Effector type Tae
Cognate immunity protein IMU38215 experimental
Related T6SS (Type) T6SS01213 experimental (Type i3)
Strain Pseudomonas aeruginosa PAK
Replicon chromosome
Sequence Protein sequence (570 a.a.); Nucleotide sequence (1710 bp)
Description Tse8 elicits toxicity by interacting with the bacterial amidotransferase complex. Tse8 toxicity depends on the presence of the transamidosome.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Y880_RS19070 (tse8)
Coordinates (Strand) 3986374..3988083 (+)
NCBI ID WP_003101313.1
RefSeq NZ_CP020659
Uniprot ID A0A069Q275_PSEAI, A0A1F0IAD0_9PSED, A0A3S4MPH7_PSEFL, Q9HWL8_PSEAE
KEGG ID pae:PA4163
PDB ID 6TE4, 6YHV

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Amidase PF01425.23 6.3e-46 25..297
Amidase PF01425.23 6.6e-06 459..544

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-569 MIEVTEVSIAELRDALESGRTTAVELVQAYLARIDAYDAPGTPTALNAVVVRNPDALAEAQASDARRARGEPLGPLDGIPYTAKDSYLVKGLTAASGSPAFKDLVAQRDAFTVERLRAAGAICLGKTNMPPMANGGMQRGVYGRAESPYNAAYLTAPFASGSSNGAGTATAASFAAFGLAEETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVVPYARSMADLLEILDVVVADDPDTRGDLWRMQPWVPIPKASEVRPASYPALAAGAEALAGKRFGVPRMFINADPDAGTSESPGIGGPTGQRIHTRPSVIALWEQARKALEAAGAEVIEVDFPLVSNCEGDRPGAPTVFNRGLVSKEFLHDELWELSAWGFDDFLRANGDPKLNRLADVDGPQIFPHDPGTLPNREGDLAAGMDEYVRMAERGIKPWDRIATLPDGLRGLEETRRIDLEEWMRRLRLDAVLFPTVADVGPADADVNPASADIAWSNGVWVANGNLAIRHLGVPTVTVPMGVMADIGMPVGLTFAGRAYDDSALLRFAAAFESTGSRRIVPPRTPPLASK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9736 - -



  Protein sequence: 570 a.a.    .

>EFF76642 NZ_CP020659:3986374-3988083 [Pseudomonas aeruginosa PAK]
MIEVTEVSIAELRDALESGRTTAVELVQAYLARIDAYDAPGTPTALNAVVVRNPDALAEAQASDARRARGEPLGPLDGIP
YTAKDSYLVKGLTAASGSPAFKDLVAQRDAFTVERLRAAGAICLGKTNMPPMANGGMQRGVYGRAESPYNAAYLTAPFAS
GSSNGAGTATAASFAAFGLAEETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVVPYARSMADLLEILDVVVA
DDPDTRGDLWRMQPWVPIPKASEVRPASYPALAAGAEALAGKRFGVPRMFINADPDAGTSESPGIGGPTGQRIHTRPSVI
ALWEQARKALEAAGAEVIEVDFPLVSNCEGDRPGAPTVFNRGLVSKEFLHDELWELSAWGFDDFLRANGDPKLNRLADVD
GPQIFPHDPGTLPNREGDLAAGMDEYVRMAERGIKPWDRIATLPDGLRGLEETRRIDLEEWMRRLRLDAVLFPTVADVGP
ADADVNPASADIAWSNGVWVANGNLAIRHLGVPTVTVPMGVMADIGMPVGLTFAGRAYDDSALLRFAAAFESTGSRRIVP
PRTPPLASK*

  Nucleotide sequence: 1710 bp    .

>EFF76642 NZ_CP020659:3986374-3988083 [Pseudomonas aeruginosa PAK]
ATGATCGAGGTCACCGAGGTTTCCATCGCCGAGCTGCGTGACGCGCTCGAGTCCGGTCGTACCACGGCGGTCGAACTGGT
CCAGGCCTACCTGGCGCGGATCGACGCCTACGATGCACCCGGCACGCCCACCGCGCTGAACGCGGTGGTGGTGCGCAATC
CCGATGCGCTGGCCGAAGCGCAGGCCTCCGACGCCCGCCGGGCGCGTGGCGAGCCCCTCGGTCCGCTGGACGGCATTCCC
TACACCGCCAAGGACAGCTACCTGGTCAAGGGCCTCACCGCGGCTTCCGGCAGCCCGGCGTTCAAGGACCTGGTGGCCCA
GCGCGATGCCTTCACCGTCGAGCGCCTGCGCGCCGCCGGGGCGATCTGCCTGGGCAAGACCAACATGCCGCCCATGGCCA
ACGGCGGCATGCAGCGCGGCGTCTACGGCCGCGCGGAGAGCCCGTACAATGCCGCCTACCTCACCGCGCCCTTCGCCTCG
GGGTCCTCCAATGGCGCCGGCACCGCCACCGCGGCCAGCTTCGCCGCCTTCGGCCTGGCCGAGGAAACCTGGTCGAGCGG
GCGCGGCCCGGCGTCGAACAACGGCCTGTGCGCCTACACCCCTTCGCGCGGGGTGATCTCGGTGCGCGGCAACTGGCCGC
TGACGCCGACCATGGACGTGGTGGTGCCCTATGCGCGGAGCATGGCCGACCTGCTGGAAATCCTCGACGTAGTGGTCGCC
GACGATCCCGATACCCGCGGCGACCTCTGGCGCATGCAGCCCTGGGTGCCGATCCCCAAGGCCTCCGAGGTACGCCCGGC
GAGCTACCCGGCCCTGGCCGCAGGCGCCGAGGCCCTGGCCGGCAAGCGCTTCGGCGTGCCGCGCATGTTCATCAACGCCG
ACCCCGATGCGGGCACCAGCGAGTCCCCCGGGATCGGCGGCCCGACCGGCCAGCGCATCCATACCCGGCCCTCGGTCATC
GCCCTCTGGGAACAGGCGCGCAAGGCCCTGGAAGCCGCCGGCGCCGAAGTGATCGAGGTGGACTTCCCGCTGGTGTCGAA
CTGCGAAGGCGACCGACCCGGCGCGCCCACCGTGTTCAACCGCGGCCTGGTGTCGAAGGAATTCCTCCACGACGAGCTGT
GGGAACTCTCGGCCTGGGGCTTCGACGACTTCCTGCGCGCCAATGGCGATCCGAAGCTGAACCGCCTGGCGGATGTCGAC
GGCCCGCAGATATTCCCCCACGACCCCGGCACCCTGCCCAACCGCGAGGGCGACCTGGCCGCCGGCATGGACGAATACGT
GCGGATGGCCGAGCGCGGCATCAAGCCCTGGGACCGGATCGCGACCCTCCCCGATGGCCTGCGCGGCCTCGAGGAAACCC
GGCGGATCGACCTCGAGGAGTGGATGCGACGCCTGCGCCTCGACGCCGTGCTCTTCCCCACCGTCGCCGACGTCGGCCCG
GCGGACGCCGACGTCAACCCGGCCTCGGCCGACATCGCCTGGAGCAACGGTGTCTGGGTCGCCAACGGCAACCTCGCCAT
CCGCCACCTCGGCGTGCCGACGGTCACCGTACCGATGGGGGTGATGGCCGACATCGGCATGCCGGTGGGCCTGACCTTCG
CCGGCCGCGCCTACGACGACTCGGCGCTGCTGCGCTTCGCCGCGGCCTTCGAGTCGACCGGCTCGCGGCGTATCGTGCCG
CCGCGTACTCCACCGCTGGCAAGCAAGTGA