Detailed information of immunity protein


Summary

Immunity protein ID IMU38208 experimental
Cognate effector EFF76630 experimental
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (248 a.a.); Nucleotide sequence (744 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS06820
Coordinates (Strand) 431552..432295 (-)
NCBI ID WP_000771534.1
RefSeq NZ_KQ410498
Uniprot ID TSIV1_VIBCH, A0A023PTD5_VIBCL, A0A0H3Q1U3_VIBCL, A0A0K9V0E4_VIBCL, A0A0X1KWL5_VIBCO, C3LMB4_VIBCM
KEGG ID vcq:EN18_10315, vcm:VCM66_1374, vch:VC1419
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-11 MKLLNNLAIKK
Transmembrane helix 12-30 LISVVVLFIALFFLGYDYY
Outside 31-247 QTSQPNIWGDEPDESYITISGKKPIDAYLEVWTHFWVTGDECEAYSYDLFGQKAHQGGKISQKITHDFAKDGSNFEFRIPYQTYKNSQNCIVELRDFSIQAHNDFDTVGFAQLRFSPAGREYYNREVDLNSLITADNCNSDIFKSIRKEWAGAIGCHFYVDGKKKTKDEEFNAYTIYYDFSKFNNDTVIHYDILAGENYRSEPLSSAQKTAVVSDDN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9251 - -



  Protein sequence: 248 a.a.    .

>IMU38208 NZ_KQ410498:c432295-431552 [Vibrio cholerae V52]
MKLLNNLAIKKLISVVVLFIALFFLGYDYYQTSQPNIWGDEPDESYITISGKKPIDAYLEVWTHFWVTGDECEAYSYDLF
GQKAHQGGKISQKITHDFAKDGSNFEFRIPYQTYKNSQNCIVELRDFSIQAHNDFDTVGFAQLRFSPAGREYYNREVDLN
SLITADNCNSDIFKSIRKEWAGAIGCHFYVDGKKKTKDEEFNAYTIYYDFSKFNNDTVIHYDILAGENYRSEPLSSAQKT
AVVSDDN*

  Nucleotide sequence: 744 bp    .

>IMU38208 NZ_KQ410498:c432295-431552 [Vibrio cholerae V52]
ATGAAGTTATTGAATAATCTTGCAATAAAAAAGCTAATCTCAGTTGTTGTACTATTCATTGCATTATTTTTTCTTGGGTA
TGACTATTACCAGACTTCTCAACCTAATATTTGGGGTGATGAACCTGATGAGTCCTATATTACTATATCAGGCAAAAAGC
CTATAGATGCTTATTTAGAAGTGTGGACTCATTTTTGGGTGACAGGAGATGAGTGTGAAGCTTATTCCTACGATTTATTT
GGTCAAAAAGCCCATCAAGGAGGAAAAATAAGCCAGAAGATTACGCATGATTTTGCTAAAGATGGTTCAAATTTTGAATT
TAGAATTCCTTACCAAACGTATAAGAACTCACAAAATTGTATAGTGGAATTAAGAGACTTTTCCATACAAGCTCATAATG
ATTTTGATACCGTAGGTTTTGCTCAGTTGCGATTTTCTCCAGCAGGCAGAGAATATTACAATCGAGAGGTTGATCTAAAC
TCATTGATTACAGCAGATAATTGCAATAGTGATATATTTAAAAGTATAAGAAAAGAGTGGGCAGGAGCCATTGGTTGTCA
TTTTTATGTCGATGGAAAGAAAAAGACTAAAGATGAAGAATTCAACGCTTACACCATCTACTACGATTTTTCGAAATTCA
ATAATGACACCGTGATTCATTACGATATTTTAGCCGGTGAAAACTATCGGTCAGAGCCTTTGTCCTCAGCTCAAAAGACA
GCAGTGGTATCTGATGATAATTAA