Detailed information of effector


Summary

Effector ID EFF76630 experimental
Effector type Tle
Cognate immunity protein IMU38208 experimental
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (642 a.a.); Nucleotide sequence (1926 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS06825 (tseL)
Coordinates (Strand) 432292..434217 (-)
NCBI ID WP_000376836.1
RefSeq NZ_KQ410498
Uniprot ID TSEL_VIBCH, A0A023PTD0_VIBCL, A0A0H3PXY5_VIBCL, A0A0K9UZ72_VIBCL, A0A0X1KWD5_VIBCO, C3LMB3_VIBCM
KEGG ID vch:VC1418, vcq:EN18_10310, vcm:VCM66_1373
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Lipase_3 PF01764.27 5e-18 320..433

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-641 MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKIAAGEWRASVSQASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWDEAPKDEFLQKQHKGIDVNASAEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSYTFALLSKLAYATNDFNRDDGKTIDNQGAISTVISQLKRKERPTYSGDLQAKWLLEEIPYSKALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSKKPPVDNTKFKIIKAASGMAAVIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALLSLMEKDLGLHKIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRHVNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTYNSNNQVLLTPKQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALSDESLMVHYQRAISALEQEIATLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLIENRNKIRGELRQIVSDPQRMPATKFLISQQTLPDEIKVQIR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9852 - -



  Protein sequence: 642 a.a.    .

>EFF76630 NZ_KQ410498:c434217-432292 [Vibrio cholerae V52]
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKIAAGEWRASVSQASLLTEVEK
YASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWDEAPKDEFLQKQHKGIDVNASAEKAGFRLSHNQTYVFEIKA
LRSYMPVIIDTDEFNLVNSYTFALLSKLAYATNDFNRDDGKTIDNQGAISTVISQLKRKERPTYSGDLQAKWLLEEIPYS
KALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSKKPPVDNTKFKIIKAASGMAAVIADKIESATDSPGMKDLII
TDLDAAQIAPEEFGGTYVHRGFYQYTMALLSLMEKDLGLHKIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGM
PRVGTRSFVERYQNILHYRHVNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTY
NSNNQVLLTPKQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALSDESLMVHYQRAISALEQEIA
TLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLIENRNKIRGELRQIVSDPQRMPATKFLISQQTLPDEIKVQI
R*

  Nucleotide sequence: 1926 bp    .

>EFF76630 NZ_KQ410498:c434217-432292 [Vibrio cholerae V52]
ATGGATTCATTTAATTATTGCGTGCAGTGTAACCCTGAGGAAAACTGGTTAGAGCTAGAGTTTCGGAGTGAAAATGATGA
ACCGATAGATGGTTTGCTAGTTACGATTACGAACCAAAGTGCCCCCTCTAACACATACACGCAAACCACAAGTTCGGGTA
AGGTGTTGTTTGGCAAGATTGCGGCTGGGGAATGGCGTGCTTCTGTAAGCCAAGCTTCTCTGTTAACTGAAGTCGAAAAA
TATGCCAGCCGTAAAGAGGGACAAGAGTCGCCAGTGAAAAAACGAGCTGCGGCAGAACTTGACGCCGCAGATAAAGATAC
GAAGCAGTACCGCTTTACCACTATTGGTGATTTCTGGGATGAAGCACCAAAAGATGAGTTTTTACAAAAGCAGCATAAAG
GGATAGATGTCAATGCTTCTGCTGAGAAAGCAGGGTTTAGACTCAGTCATAACCAGACCTATGTTTTTGAAATCAAAGCA
CTACGTAGCTATATGCCAGTGATTATTGATACCGATGAATTTAACTTGGTGAATAGTTATACCTTTGCGTTGTTGTCGAA
ATTAGCTTATGCGACTAACGATTTTAATAGGGATGATGGTAAGACAATAGATAATCAGGGAGCAATTAGCACGGTTATTT
CTCAATTGAAGCGTAAAGAAAGACCGACTTATTCTGGAGATTTACAAGCAAAGTGGTTATTAGAGGAAATTCCATATAGC
AAAGCGTTAAGTGCCCAATATTATGCTGAGGATGATGTCGGTAGTGAAGGTTACATCATCTTTAACGATGAATTGGCGAT
TATAGGTGTGAGAGGTACAGAGCCTTATTTTCAGAGTAAGAAACCACCTGTTGATAACACTAAATTTAAAATTATAAAAG
CGGCTTCAGGTATGGCGGCTGTGATTGCGGATAAGATAGAAAGTGCTACCGATTCACCAGGAATGAAAGACCTTATTATA
ACAGACCTTGATGCTGCGCAAATCGCCCCCGAAGAGTTTGGTGGAACATATGTTCATCGGGGGTTTTACCAATATACGAT
GGCTTTGTTATCTTTGATGGAGAAAGATCTAGGGCTACATAAAATAAAAAAATTCTATTGTTGTGGCCATAGCTTAGGGG
GCGCTGGTGCATTACTTATAAGTGCATTGATTAAAGATAGCTATCATCCTCCAGTATTGCGTTTATATACATATGGAATG
CCACGAGTGGGAACTCGCAGTTTTGTAGAGCGCTATCAAAATATTTTGCATTACCGTCATGTTAATAATCACGATTTGGT
GCCACAGATACCAACAGTATGGATGAACACAGATGTATCTGAAGGATTCCATGTACTTGATGTATTTAAAAGCCGTGTTG
ATCTGATGAGAAAAATGCTCACTGATGATGATGATGACAATTATCAACACCATGGTCATTTGTCTCAGTTACTAACTTAT
AATTCAAATAACCAAGTCTTACTGACACCCAAACAAACTCAAGTCACTATGCTAGACCTAGCAAATTTAGCCACTAATGA
TTCTGTTGCTATGGTAGATGGTTTATCAGATGCCTCAATAGTAGAGCATGGAATGGAGCAGTATATACCCAATTTATTTG
AGCAGTTAACAGCACTAAGTGATGAAAGTTTAATGGTGCATTATCAACGAGCGATTTCAGCCTTAGAGCAGGAAATTGCT
ACGTTGCAACAAAGTTATCTTACAGTTAAACAAGCTTGGATTGAATCTATAGGAAATGGCACGCCGACTATGAATATCGG
ACGTTTGATGAGTGAAATGCATTCTATAAATAAATTAATAGAGAACCGTAATAAAATTAGAGGTGAGCTAAGGCAGATAG
TCTCTGATCCTCAGCGTATGCCTGCAACTAAATTTTTAATTTCACAGCAAACCTTACCAGATGAAATCAAGGTGCAAATA
AGATGA