Detailed information of immunity protein


Summary

Immunity protein ID IMU38207 experimental
Cognate effector EFF76627 experimental
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (243 a.a.); Nucleotide sequence (729 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS01465
Coordinates (Strand) 315306..316034 (-)
NCBI ID WP_000904079.1
RefSeq NZ_KQ410497
Uniprot ID TSIV2_VIBCH, A0A023PS90_VIBCL, A0A0H3AF62_VIBC3, A0A0H3QAG2_VIBCL, A0A0K9UVD0_VIBCL, A0A0X1L1F4_VIBCO, C3LU50_VIBCM
KEGG ID vcq:EN18_03875, vcm:VCM66_A0020, vch:VCA0021, vco:VC0395_0112
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-38 MLIDKNELEQLKVKLHSSEVIYQWDSVAYGERRSEIFR
Transmembrane helix 39-61 VFGAISAGIVPLWPFIFFADIQF
Outside 62-65 NSKE
Transmembrane helix 66-85 FWGFICFSLAGMAAARYLFM
Inside 86-116 PDHRYCYSLTQAGIYYTDQEVIPDAAYTFVR
Transmembrane helix 117-139 GFAWVGIAVCLLALAVVGPLAFV
Outside 140-242 GAGGFALLAFGLTNFHPTVHKKEVYFADQLIVFDPIKEKMVDLNTDSTDEPWFDRRLFFSSLDEKTHFIELVKSIHNNVDYLPLQRVNDQYKHPIFNQELKEE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9583 - -



  Protein sequence: 243 a.a.    .

>IMU38207 NZ_KQ410497:c316034-315306 [Vibrio cholerae V52]
MLIDKNELEQLKVKLHSSEVIYQWDSVAYGERRSEIFRVFGAISAGIVPLWPFIFFADIQFNSKEFWGFICFSLAGMAAA
RYLFMPDHRYCYSLTQAGIYYTDQEVIPDAAYTFVRGFAWVGIAVCLLALAVVGPLAFVGAGGFALLAFGLTNFHPTVHK
KEVYFADQLIVFDPIKEKMVDLNTDSTDEPWFDRRLFFSSLDEKTHFIELVKSIHNNVDYLPLQRVNDQYKHPIFNQELK
EE*

  Nucleotide sequence: 729 bp    .

>IMU38207 NZ_KQ410497:c316034-315306 [Vibrio cholerae V52]
ATGTTAATTGATAAAAATGAGTTAGAGCAGTTAAAGGTAAAATTACACAGCAGTGAGGTTATTTATCAATGGGATAGTGT
GGCTTACGGAGAGAGAAGATCTGAAATATTTCGCGTTTTTGGGGCAATCTCTGCTGGTATTGTTCCCCTTTGGCCATTTA
TTTTTTTTGCAGATATTCAATTTAATAGTAAAGAGTTTTGGGGATTTATCTGCTTTAGTCTGGCGGGCATGGCTGCTGCC
AGATATCTTTTTATGCCCGACCACCGTTATTGCTACAGTTTAACGCAAGCGGGGATTTATTATACGGATCAAGAAGTGAT
CCCAGATGCGGCCTACACTTTTGTGCGTGGTTTTGCTTGGGTGGGGATTGCGGTCTGTTTGTTAGCCTTAGCCGTCGTTG
GCCCGTTAGCGTTTGTCGGTGCGGGCGGTTTTGCCCTGCTGGCCTTTGGTTTGACCAACTTCCACCCCACCGTACATAAG
AAAGAGGTTTACTTTGCTGACCAATTGATTGTTTTTGATCCCATCAAAGAAAAGATGGTGGATTTAAATACAGATAGCAC
AGATGAACCATGGTTTGACAGACGGCTATTTTTTAGTTCACTTGATGAGAAGACGCATTTTATTGAGCTCGTGAAGAGTA
TTCATAATAATGTCGACTATCTTCCGTTACAGCGAGTTAACGATCAGTACAAGCATCCAATCTTTAATCAAGAATTAAAA
GAGGAATAG