Detailed information of effector


Summary

Effector ID EFF76627 experimental
Effector type Tme
Cognate immunity protein IMU38207 experimental
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (1086 a.a.); Nucleotide sequence (3258 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS01470 (vasX)
Coordinates (Strand) 316035..319292 (-)
NCBI ID WP_000070352.1
RefSeq NZ_KQ410497
Uniprot ID VASX_VIBCH, A0A023PTD1_VIBCL, A0A0H3AFI2_VIBC3, A0A0H3Q300_VIBCL, A0A0K9UXX8_VIBCL, A0A0X1L1E1_VIBCO
KEGG ID vcq:EN18_03870, vco:VC0395_0113, vch:VCA0020
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-756 MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWKGQFSIKQRSYTLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSKGESKSCLLYPAQHTLSIGYAHQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHAHFAQYLEDYVADIGTPAEQDIFKDTCTPSLPVEKSEEAVKGTEFKFVADKAVVSSSDYLQDLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGDETQQHKMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESHHLASEGHSPSGNYALMQQQAEQKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHYAQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSFDSPKNLMALASTGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDERIQEKAWFKRWIEPAQSSFGALQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAELKQFETKLNAILQEMNDALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALSKNVKTSSASVSQKLGGLGGLLFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGE
Transmembrane helix 757-779 AIYATGNTIVVAGAISAGRAWVT
Inside 780-859 IAEQGLLDRTLKNALNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSKTDLERFGYLLKAGATGAQG
Transmembrane helix 860-882 IIFYIQFFTLLGSGIGGPSIAAI
Outside 883-885 SAG
Transmembrane helix 886-908 WMLAGFAVIGIVYLIGVILTNVF
Inside 909-1085 KRSELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLKGQTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLRWGKELSLKFYASGTRAGELDLQSAEANDIATRNLVVGKG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9607 - -



  Protein sequence: 1086 a.a.    .

>EFF76627 NZ_KQ410497:c319292-316035 [Vibrio cholerae V52]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWKGQFSIKQRSYTLRQLRDGWL
YVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSKGESKSCLLYPAQHTLSIGYAHQRWTWRVCEHMRSNTSSRH
AVMRKVSLKQFESNGTHPHAHFAQYLEDYVADIGTPAEQDIFKDTCTPSLPVEKSEEAVKGTEFKFVADKAVVSSSDYLQ
DLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGDETQQHKMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILEL
ERAITEYCATAKLAEIESHHLASEGHSPSGNYALMQQQAEQKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDN
FLVEHYTELKGLDEQIKQHYAQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSF
DSPKNLMALASTGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDERIQEKAWFKRWIEPAQSSFGA
LQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAELKQFETKLNAILQEMNDA
LELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALSKNVKTSSASVSQKLGGLGGL
LFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGAISAGRAWVTIAEQGLLDRTLKNALNTTKVL
GTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSKTDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIA
AISAGWMLAGFAVIGIVYLIGVILTNVFKRSELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQW
MDSGSLQWQLELTLPDYLKGQTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVC
VALPLRWGKELSLKFYASGTRAGELDLQSAEANDIATRNLVVGKG*

  Nucleotide sequence: 3258 bp    .

>EFF76627 NZ_KQ410497:c319292-316035 [Vibrio cholerae V52]
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGACAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTCCTTTTAAACA
GCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATGATCAAGGTCAAGCATTACATCCTTTACCCA
AAGCGGATCGACAGTGGAAAGGTCAATTCTCTATCAAGCAGCGCAGTTACACTTTAAGGCAACTGCGTGATGGCTGGCTC
TATGTCTATGATGAAACAGCAAAAACACTGCACGAATATGAAGTCGTTGGCTGCAAGTTGACCAAAATTGATTGGTCTGA
TGATGAGGCAAACAAACCCACTCACGAGCGCGGTTCGAAAGGTGAAAGCAAAAGCTGTTTACTCTATCCCGCCCAGCACA
CGCTCTCTATCGGTTATGCGCATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGCCGTCAT
GCTGTGATGCGTAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCCTCATGCACATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCAGCTGAGCAGGATATTTTTAAAGATACCTGTACCCCTTCATTACCGGTAGAGA
AAAGTGAAGAAGCGGTGAAAGGTACGGAATTCAAATTCGTTGCCGACAAAGCGGTGGTAAGCAGCAGTGATTATTTGCAA
GATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTTAGCGGATGTGTCAGATTTATTTGTTACTTT
TACTACCCAAGTGGCAAAGCGAACTAAAGCGATTGGTGATGAAACGCAACAGCATAAAATGCAGATGGCAGAGCTGACAC
GCACATTAGGCCGAATTCGTCTTGAAGAAAAAGAAATTCCCGATTTTGTAAAACAAGATCCGATCCGTATTTTAGAGCTA
GAAAGAGCCATTACTGAATATTGTGCTACGGCAAAATTGGCCGAAATCGAATCTCATCATTTAGCCAGTGAAGGGCATTC
CCCATCGGGAAACTATGCCTTGATGCAGCAGCAAGCGGAGCAGAAACTGGCGGAATTGAAAACACTCTATCGCTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACAGCTTTATTGATGAAGTGCGTTGGGCGGATTTAGATAAC
TTTTTGGTGGAGCATTACACCGAGCTCAAAGGATTGGATGAACAGATTAAACAACACTATGCGCAGTTTATGTCTGCCTT
CAACCAGCTCGGCCTTGACCCGCTTCTGTTTGGTATGGATAACCAAGATGAGGTTCAGCAAGCGTATTTGTTAGCATTAA
CTAGCCAATTTTTAGTGGTGGTTACGCAAGTCAATCATGATGAAAAATCGCTTGAGATCCTAAAAAAAGATCTCAGTTTT
GATTCACCGAAAAACCTCATGGCCCTCGCGTCAACAGGCTTTTCCCTGCAGGCAAATCAAGCCATTAACAACCATATCCA
AGGGTTTAGCACCGCTTTTCTCTCTACAAGTAATCCTAGTGATATGGTGGCGTTTGCGACCGCAATCGCTAACTGGGATA
CGTTCACGGGGGATGAACGTATTCAGGAGAAAGCATGGTTTAAGAGATGGATTGAACCCGCTCAATCGAGTTTTGGTGCA
CTGCAAAAAGCGGTCGCCAATCAAGCCAAAGAGAGTTGGCAAGCGGTGATGGAGTTGCTGTTTCCTTATCAGAATCAGCC
CAAAGGAGGGACGCCCAGTTTGTTGGCTAACCTTCGTTTACTGTTGGTGGAAAGCCTAGTTCGAGAAGAGGCGGTGCTGC
AACATAACCCCAAGTATGCGGCTGAGCTTAAGCAATTTGAGACTAAGCTGAATGCCATTTTGCAAGAGATGAATGATGCT
CTGGAACTCAAACCCGGTAATGTGAGCCCGAAAAACCATCAAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCA
ATTACTCAGTAGTGAGCTGCCGATGATGCTGACGCTCAAAAACCAAGCTGCGATGAACACTTTTCAGCAGTCGGTAAATG
AGAAACTGAGCGCGCTATCGAAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAGAAACTGGGTGGATTAGGGGGCTTG
CTGTTTGCGTTGAACCTATGGAATACCATGACGGTTTTGGAGAATATCCGCTATAAGGTCGCACAATACCCCAGTTGGAA
TCCTTTTAAGAACCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCAACACTATTGTAGTCGCCGGTGCCATTAGTGCTG
GGCGAGCTTGGGTGACGATTGCTGAGCAAGGGTTGTTAGATCGTACACTGAAAAACGCCTTAAATACCACGAAAGTTTTG
GGCACAAAAGATGCCCTAAAAACCTTTGCTAAATCGATCGCCTTGGTGGCTACCGTGGGCATGATTGCCAGCGCATTAGA
AACATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAAACCGATCTTGAACGCTTCGGTTATTTGTTAAAAGCTGGAG
CAACGGGAGCACAGGGAATTATTTTTTATATTCAGTTTTTCACACTCTTAGGTAGTGGAATTGGTGGACCCTCCATAGCT
GCGATTTCTGCAGGTTGGATGCTCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGT
GTTTAAACGCTCAGAGTTAGAAATTTGGTTATCAAAATCGACGTGGGGGAAAGAGAGTGCTCATTGGCCAGTGGGCAAAG
AATTGACCGAGTTAGAGCACCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAAAGCAGCGCAATGG
ATGGATTCAGGTTCTTTACAATGGCAGTTGGAACTCACGTTACCCGATTATCTTAAGGGGCAGACGATAGGCTTACAAAT
CACCCGTTTGCCAGCGCAGCCGGCATATTATCAACCGCAAAGGGAGGCGGTAACACCAATACTCATCAATGAACAACAGG
GCAAATGGAGTATTGAAGATAATCAGCCAGTGTATCGTATTACACTGGGTGGCAGTGAGAAGGATACTGTCGGAGTTTGC
GTTGCACTGCCCCTGCGTTGGGGCAAGGAGCTGAGCCTCAAATTCTATGCCAGTGGAACTCGCGCGGGGGAATTGGATTT
ACAATCTGCAGAGGCGAATGATATTGCCACAAGAAATCTCGTTGTAGGAAAAGGTTAA