Detailed information of immunity protein


Summary

Immunity protein ID IMU38206 experimental
Cognate effector EFF76626 experimental
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (76 a.a.); Nucleotide sequence (228 bp)
Description -
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS20260
Coordinates (Strand) 31747..31974 (-)
NCBI ID WP_001911595.1
RefSeq NZ_KQ410497
Uniprot ID A0A8B0IX20_VIBCO
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-75 MIWFPEPTATGLSIVENKHPIYTIRITCGSPDNICHEGLFEYKGNTLSKIEIRDFASYLGEEITLTNGETLEPMN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9150 - -



  Protein sequence: 76 a.a.    .

>IMU38206 NZ_KQ410497:c31974-31747 [Vibrio cholerae V52]
MIWFPEPTATGLSIVENKHPIYTIRITCGSPDNICHEGLFEYKGNTLSKIEIRDFASYLGEEITLTNGETLEPMN*

  Nucleotide sequence: 228 bp    .

>IMU38206 NZ_KQ410497:c31974-31747 [Vibrio cholerae V52]
ATGATTTGGTTCCCAGAGCCCACAGCAACGGGTCTCAGTATTGTAGAGAATAAACATCCTATCTATACGATTCGTATAAC
GTGTGGCTCTCCGGATAATATTTGCCATGAAGGCCTATTTGAGTACAAAGGGAACACACTAAGCAAAATTGAGATAAGAG
ATTTTGCTAGCTATTTAGGTGAAGAAATCACCTTAACGAATGGTGAAACCTTAGAACCTATGAATTGA