Detailed information of effector


Summary

Effector ID EFF76626 experimental
Effector type Tae
Cognate immunity protein IMU38206 experimental
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (224 a.a.); Nucleotide sequence (672 bp)
Description -
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS00220
Coordinates (Strand) 32099..32770 (-)
NCBI ID WP_000132861.1
RefSeq NZ_KQ410497
Uniprot ID A0A0H3AEA5_VIBC3, A0A0H3Q2N3_VIBCL, A0A0H7IDZ2_VIBCL, A0A0K9UY08_VIBCL, A0A0X1L2B8_VIBCO, C3LUV6_VIBCM, Q9KMN9_VIBCH
KEGG ID vcq:EN18_00150, vcx:VAA049_1600, vcm:VCM66_A0284, vch:VCA0285, vco:VC0395_0944
PDB ID 6V98

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-223 MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILINGETGVTRYYEYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRGKFFSEADSWLRGKMDLNNSPDKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDLDYDYKTNKLTVSE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9894 - -



  Protein sequence: 224 a.a.    .

>EFF76626 NZ_KQ410497:c32770-32099 [Vibrio cholerae V52]
MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILINGETGVTRYY
EYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRGKFFSEADSWLRGKMDLNNSP
DKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDLDYDYKTNKLTVSE*

  Nucleotide sequence: 672 bp    .

>EFF76626 NZ_KQ410497:c32770-32099 [Vibrio cholerae V52]
ATGACTGACACTGTATCATCAACTCCAGTAGCCGATACAACTCCATATGAGATATTTCTTTCAGGTAATGACGATTTTTT
GATACCTGTAGTATTTCCTGACTACCTAATCTCAGTCGCAGATGAACAATCTTTTGAGTTATGGGGTGTAAAAATAAAAA
CTCCTGCAGTGAAGGCCCCCTACCTTGGTCACGCTGGAGTTATTTTGATTAATGGTGAAACAGGTGTTACTCGCTATTAT
GAGTATGGCCGTTACAAGAACCCTAAATCGGATATCCCAGGAAATGTGAGGAAGGTTGGGGTATCAAATGTAACTATAAA
AAGTGGTCTAATTACTGAAAGCTCGTTACTGAAGGTTCTTAAAGAAGTGTCCCTACGTTCTGGACAGGAGGGGAGAATTT
CGGGAGTGGTATTAAGAGGAAAGTTTTTCTCTGAAGCAGATTCATGGTTAAGGGGAAAAATGGATCTTAATAATAGCCCT
GATAAGATACCTTATGACTTGGATAGCCATAACTGCATGACATTTGTCATAGATTTAGCTGATGCAATGGGGTTAGACCC
GGCTTGGAAACCTCCTGTTGTTGTACCAAGCGCGTATATTGAACAGTTTCAGTTAAGTGAAATTGATTTAGATTATGACT
ATAAGACCAACAAATTAACGGTATCTGAGTGA