Detailed information of immunity protein


Summary

Immunity protein ID IMU00382 experimental
Cognate effector EFF01891 experimental
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (363 a.a.); Nucleotide sequence (1089 bp)
Description In vivo Escherichia coli toxicity assay further supported this deduction. Isopropyl b-D- 1-thiogalactopyranoside (IPTG) induced expression of TseV substantially reduced the growth of E. coli cells and the toxicity of TseV could be rescued by co-expres- sion with TsiV.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0821 (TsiV)
Coordinates (Strand) 897335..898423 (-)
NCBI ID 15596018
RefSeq NC_002516
Uniprot ID Q9I5B8_PSEAE
KEGG ID pae:PA0821
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF3396 PF11876.10 8.5e-64 125..331

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-362 MEQPFDLAAELAKQPHLLEIAGNLLMKSGPEDYIGAVLCLRGTLYFKKAHTPLVRESLCQCFDEFERLAEPHLTWLWREEPAQGKPLTAYRDTQPLREMMGAMDEDDHLSFCYTSGKKSRDAGAWLFDIYGKRSWQAKMGHDLSVLEFSVPLLYQERQPLDFLQLFIDFARRLEPEQGYAGHAYNLSPTSWDNDEPSEAFMAARMPGLDVGTACLLANTPEFKPTRIKTVSWLTLLNNERLALAGGLDALRAQLPSSHFAFYRYGDGVVIQAGAYPYIAGDAEDSRPAPYVLLNHALKGIRYETIGSLHGGSHDGELRLVGWAADQWLKRLDVEDSEIPRWCDKLLSAEPYLDATNTLPERL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9939 - -



  Protein sequence: 363 a.a.    .

>IMU00382 NC_002516:c898423-897335 [Pseudomonas aeruginosa PAO1]
MEQPFDLAAELAKQPHLLEIAGNLLMKSGPEDYIGAVLCLRGTLYFKKAHTPLVRESLCQCFDEFERLAEPHLTWLWREE
PAQGKPLTAYRDTQPLREMMGAMDEDDHLSFCYTSGKKSRDAGAWLFDIYGKRSWQAKMGHDLSVLEFSVPLLYQERQPL
DFLQLFIDFARRLEPEQGYAGHAYNLSPTSWDNDEPSEAFMAARMPGLDVGTACLLANTPEFKPTRIKTVSWLTLLNNER
LALAGGLDALRAQLPSSHFAFYRYGDGVVIQAGAYPYIAGDAEDSRPAPYVLLNHALKGIRYETIGSLHGGSHDGELRLV
GWAADQWLKRLDVEDSEIPRWCDKLLSAEPYLDATNTLPERL*

  Nucleotide sequence: 1089 bp    .

>IMU00382 NC_002516:c898423-897335 [Pseudomonas aeruginosa PAO1]
ATGGAACAGCCATTCGATCTGGCTGCAGAGTTAGCCAAGCAACCCCATCTACTGGAAATAGCCGGCAACCTGTTGATGAA
GAGCGGCCCCGAAGACTATATCGGTGCTGTGCTTTGCCTACGCGGCACTCTCTACTTCAAAAAGGCCCATACCCCACTGG
TACGTGAGTCATTATGCCAATGCTTCGATGAGTTCGAGCGCCTGGCAGAGCCTCACCTCACCTGGCTCTGGCGTGAAGAG
CCTGCACAAGGAAAGCCACTGACCGCATACCGTGACACCCAACCACTGCGCGAGATGATGGGGGCAATGGATGAAGACGA
TCATCTCAGCTTCTGCTACACCAGCGGCAAGAAATCCCGCGATGCAGGCGCCTGGCTGTTTGATATTTACGGCAAGCGGA
GCTGGCAAGCCAAAATGGGGCATGATCTTAGTGTTCTGGAGTTCTCCGTACCTCTGCTATATCAAGAGCGGCAGCCATTG
GATTTCCTACAGCTGTTTATTGACTTCGCACGGCGACTAGAGCCGGAGCAGGGGTATGCGGGGCATGCCTACAATCTCTC
GCCGACCAGTTGGGACAATGACGAGCCCTCCGAAGCCTTTATGGCGGCGCGTATGCCGGGTTTGGATGTAGGGACGGCTT
GTCTGCTGGCCAATACTCCCGAGTTCAAACCTACAAGAATCAAAACTGTCAGTTGGCTAACCCTCCTGAACAACGAGCGC
CTGGCGCTGGCCGGCGGGCTCGATGCCCTGCGTGCGCAACTGCCCTCCAGCCACTTTGCCTTCTACCGCTACGGCGATGG
CGTGGTAATCCAGGCCGGTGCCTATCCCTATATCGCGGGTGATGCGGAAGACTCCAGGCCCGCTCCGTATGTGCTGCTGA
ACCACGCGCTCAAAGGCATTCGCTATGAAACCATCGGCTCGCTACACGGCGGCTCCCACGACGGCGAATTGCGGCTGGTG
GGCTGGGCGGCCGATCAATGGCTGAAACGGCTGGATGTGGAAGACAGCGAGATTCCCCGGTGGTGCGACAAACTGCTCAG
CGCTGAGCCTTACCTGGACGCGACGAATACGCTGCCGGAGCGCCTGTAG