Detailed information of effector


Summary

Effector ID EFF01891 experimental
Effector type Tne
Cognate immunity protein IMU00382 experimental
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (149 a.a.); Nucleotide sequence (447 bp)
Description The PA0823 fused PA0822 gene was generated by mutate the stop codon TAA of PA0823 gene into TAC from the P. aeruginosa PAO1 genomic DNA thus generating a sequence encoding a 233AA protein from the N terminal of PA0823 to the C-terminal of TseV. in vivo Escherichia coli toxicity assay further supported this deduction. Isopropyl b-D- 1-thiogalactopyranoside (IPTG) induced expression of TseV substantially reduced the growth of E. coli cells and the toxicity of TseV could be rescued by co-expression with TsiV.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0822 (TseV)
Coordinates (Strand) 898440..898886 (-)
NCBI ID -
RefSeq NC_002516
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VRR_NUC PF08774.13 1e-06 43..93

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-148 MTKNPPQPILDSQTGNSPHGWIPGWISKYWDEDPEHPPFKPGKGMIRRPDVIIVQNPNRPPTQDNIKQVVEMKFPPDPHNREQLEDYAAIAGNKNKIVEMKPSDCDCGQENQRSKVPVEQAGWAVAIAGGVMFVLTRGRSPRPMIPAY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9824 - -



  Protein sequence: 149 a.a.    .

>EFF01891 NC_002516:c898886-898440 [Pseudomonas aeruginosa PAO1]
MTKNPPQPILDSQTGNSPHGWIPGWISKYWDEDPEHPPFKPGKGMIRRPDVIIVQNPNRPPTQDNIKQVVEMKFPPDPHN
REQLEDYAAIAGNKNKIVEMKPSDCDCGQENQRSKVPVEQAGWAVAIAGGVMFVLTRGRSPRPMIPAY*

  Nucleotide sequence: 447 bp    .

>EFF01891 NC_002516:c898886-898440 [Pseudomonas aeruginosa PAO1]
ATGACCAAGAACCCACCGCAGCCGATTCTCGATAGCCAGACCGGTAACAGTCCACATGGCTGGATACCGGGATGGATCAG
CAAGTATTGGGATGAAGATCCGGAGCATCCGCCGTTCAAGCCAGGGAAAGGAATGATTCGCAGGCCCGACGTGATCATCG
TTCAGAATCCCAACAGGCCGCCAACCCAGGACAATATCAAGCAGGTGGTGGAGATGAAGTTTCCGCCTGACCCACATAAT
AGGGAACAACTTGAGGATTATGCAGCGATTGCCGGCAACAAGAACAAGATTGTTGAAATGAAACCCTCCGACTGCGACTG
TGGCCAGGAAAATCAACGATCCAAGGTGCCAGTAGAGCAAGCAGGGTGGGCCGTCGCCATCGCAGGTGGAGTGATGTTCG
TCTTGACCCGAGGCCGTTCCCCTCGCCCGATGATTCCCGCCTATTGA