Detailed information of immunity protein


Summary

Immunity protein ID IMU00376 experimental
Cognate effector EFF01874 experimental
Related T6SS (Type) T6SS00260 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (95 a.a.); Nucleotide sequence (285 bp)
Description Expression of YPK_0954, a 67-amino acid (aa) protein in E. coli results in significant growth inhibition. This growth inhibition was relieved by co-expression of the immediately downstream gene YPK_0955, which encodes a protein containing the colicin_immundomaininthe ypk_0954-ypk_0955 bicistron (Fig. 1c). This result suggests that YPK_0955 is the cognate immunity protein for YPK_0954. We
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) YPK_0955 (Tci1)
Coordinates (Strand) 1070252..1070536 (+)
NCBI ID 499506273
RefSeq NC_010465
Uniprot ID A0A0E8XP54_9GAMM, A0A0H3B1F5_YERPY, A0A0T9MZ29_YERPU, A0A0T9RNQ6_9GAMM, Q666Y0_YERPS
KEGG ID ypu:BZ21_2431, ypr:BZ20_3049, ypc:BZ23_2710, ypq:DJ40_3364, ysi:BF17_02060, ypo:BZ17_3504, ypy:YPK_0955, yps:YPTB3114
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Colicin_immun PF09204.12 3e-37 1..87

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-94 MSIVILEFAKSFINERVSAQVFANAYIEFWRIERDQRICLKDNEKLSECLSSIFCLADLYNPDSDREEYELDDKQLYEQVLQLINKLNQDALNK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9937 - -



  Protein sequence: 95 a.a.    .

>IMU00376 NC_010465:1070252-1070536 [Yersinia pseudotuberculosis YPIII]
MSIVILEFAKSFINERVSAQVFANAYIEFWRIERDQRICLKDNEKLSECLSSIFCLADLYNPDSDREEYELDDKQLYEQV
LQLINKLNQDALNK*

  Nucleotide sequence: 285 bp    .

>IMU00376 NC_010465:1070252-1070536 [Yersinia pseudotuberculosis YPIII]
ATGAGCATAGTTATTTTAGAATTCGCTAAATCATTTATTAATGAAAGAGTGTCAGCGCAGGTTTTTGCGAATGCTTACAT
TGAGTTTTGGAGGATAGAGCGTGACCAACGTATCTGTCTTAAAGACAATGAAAAATTAAGCGAGTGCTTATCAAGTATAT
TTTGTTTGGCTGATCTCTATAATCCTGACTCAGACAGAGAGGAATATGAACTTGACGATAAGCAACTATATGAACAAGTT
CTACAGCTCATCAATAAACTAAATCAGGACGCTCTAAATAAATAG