Detailed information of effector


Summary

Effector ID EFF01874 experimental
Effector type Tde
Cognate immunity protein IMU00376 experimental
Related T6SS (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (86 a.a.); Nucleotide sequence (258 bp)
Description Tce1 exhibits Ca2+,Mg2+-dependent DNase activity and mediates contact-independent T6SS killing
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) YPK_0954 (Tce1)
Coordinates (Strand) 1069948..1070205 (+)
NCBI ID 488156855
RefSeq NC_010465
Uniprot ID Q666X9_YERPS
KEGG ID yps:YPTB3115
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-85 MVANGNVESISLPEVRRLMSGELDRSSASEWAFAIIDDDHIRVSDQVVWKVLQCLGGADLPITDREYLYEKEDFNCWLNEIDSHE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9928 - -



  Protein sequence: 86 a.a.    .

>EFF01874 NC_010465:1069948-1070205 [Yersinia pseudotuberculosis YPIII]
MVANGNVESISLPEVRRLMSGELDRSSASEWAFAIIDDDHIRVSDQVVWKVLQCLGGADLPITDREYLYEKEDFNCWLNE
IDSHE*

  Nucleotide sequence: 258 bp    .

>EFF01874 NC_010465:1069948-1070205 [Yersinia pseudotuberculosis YPIII]
ATGGTAGCAAATGGTAACGTTGAGAGCATTTCACTGCCGGAGGTAAGGCGCTTAATGTCAGGGGAACTTGACCGCTCAAG
CGCCTCTGAATGGGCGTTTGCAATAATTGATGATGATCACATTCGAGTAAGCGATCAGGTTGTTTGGAAAGTACTTCAAT
GCTTGGGGGGAGCAGATTTACCGATAACTGACAGGGAGTATTTATATGAAAAAGAAGACTTTAATTGCTGGCTCAACGAA
ATTGACTCACATGAGTAA