Detailed information of immunity protein


Summary

Immunity protein ID IMU00328 experimental
Cognate effector EFF01527 experimental
Related T6SS (Type) T6SS00947 experimental (Type Unknown)
Strain Escherichia coli strain PE050
Replicon chromosome
Sequence Protein sequence (150 a.a.); Nucleotide sequence (450 bp)
Description ETEC PE050 cells deploy VT1 by T6SS to inhibit other cells and protect themselves with immunity protein VTI1
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) vt6C (VTI1)
Coordinates (Strand) 3177..3626 (+)
NCBI ID 1062685203
GenBank KX118292
Uniprot ID UPI0001E8D974
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-149 MFMNMIKLVIKQKVKALISIVLINFFFCSNSYSEEKIEIININKPIYIGTNQSDKVLITACNHWVLNSRDIIDIFNLSIKHDDYGEINRMYYWLPCEIRGRLMYDGIEWSFVINAAATAMWMSNDKEIYWGCNKKACDNFFLLPYDGMR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.6052 pos: 33-34. SYS-EE. MFMNMIKLVIKQKVKALISIVLINFFFCSNSYS



  Protein sequence: 150 a.a.    .

>IMU00328 KX118292:3177-3626 [Escherichia coli]
MFMNMIKLVIKQKVKALISIVLINFFFCSNSYSEEKIEIININKPIYIGTNQSDKVLITACNHWVLNSRDIIDIFNLSIK
HDDYGEINRMYYWLPCEIRGRLMYDGIEWSFVINAAATAMWMSNDKEIYWGCNKKACDNFFLLPYDGMR*

  Nucleotide sequence: 450 bp    .

>IMU00328 KX118292:3177-3626 [Escherichia coli]
ATGTTTATGAACATGATAAAATTAGTTATAAAACAGAAGGTGAAGGCGCTGATCTCTATAGTGTTAATTAATTTCTTTTT
TTGTTCAAATAGTTACTCCGAAGAAAAAATAGAGATAATAAACATTAATAAACCAATATATATAGGTACCAATCAATCAG
ATAAGGTGCTTATTACTGCGTGTAATCATTGGGTGCTTAATTCTAGAGATATTATAGACATATTCAATCTAAGTATAAAG
CATGATGATTATGGCGAAATAAACAGAATGTATTATTGGTTACCTTGTGAAATTAGAGGGAGACTAATGTATGACGGAAT
AGAATGGAGTTTTGTTATCAATGCTGCTGCAACAGCAATGTGGATGAGCAATGATAAAGAGATTTACTGGGGATGCAATA
AAAAAGCATGCGATAATTTCTTTTTATTACCATATGATGGGATGAGGTAA