Detailed information of effector


Summary

Effector ID EFF01527 experimental
Effector type Tae
Cognate immunity protein IMU00328 experimental
Related T6SS (Type) T6SS00947 experimental (Type Unknown)
Strain Escherichia coli strain PE050
Replicon chromosome
Sequence Protein sequence (218 a.a.); Nucleotide sequence (654 bp)
Description VT1 is a novel amidase effector for peptidoglycan degradation of target cell walls and a significant decrease in E. coli survival and optical density when periplasmic localized VT1 (Peri-VT1)
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) vt6B (VT1)
Coordinates (Strand) 2514..3167 (+)
NCBI ID 1062685203
GenBank KX118292
Uniprot ID A0A0J2B9J7_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Amidase_2 PF01510.27 6.9e-12 77..210

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-217 MSKNVILSNGERENPSPLIYDKHKKHCIFRTKTLLSEEKKEDEKCTVSVVFIDHEGYIRNAGIIKHTVPELEEGRMPKINAIILHRTDSSTINGTLASFSKGIGAHFIVEKDGNIYQAASLFVYTSHVGKIKSRCKEEKTWSSEEKKKIEAFGWNAKKIHDHEKIKQYPYRYPYNMDSVGIEVIALYDKKNKKWESATDSQKKSIEKLVDIIKIFMS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9928 - -



  Protein sequence: 218 a.a.    .

>EFF01527 KX118292:2514-3167 [Escherichia coli]
MSKNVILSNGERENPSPLIYDKHKKHCIFRTKTLLSEEKKEDEKCTVSVVFIDHEGYIRNAGIIKHTVPELEEGRMPKIN
AIILHRTDSSTINGTLASFSKGIGAHFIVEKDGNIYQAASLFVYTSHVGKIKSRCKEEKTWSSEEKKKIEAFGWNAKKIH
DHEKIKQYPYRYPYNMDSVGIEVIALYDKKNKKWESATDSQKKSIEKLVDIIKIFMS*

  Nucleotide sequence: 654 bp    .

>EFF01527 KX118292:2514-3167 [Escherichia coli]
ATGAGCAAAAATGTAATATTAAGTAATGGGGAAAGAGAAAATCCTTCTCCGCTGATCTATGACAAGCATAAAAAGCACTG
TATTTTTCGTACAAAGACATTACTTAGTGAAGAGAAAAAAGAAGACGAAAAATGTACTGTATCAGTTGTATTTATTGATC
ATGAGGGGTATATAAGAAATGCTGGAATTATAAAACACACAGTCCCTGAACTTGAAGAAGGTCGCATGCCTAAAATTAAT
GCAATAATATTGCATAGAACAGATTCTTCAACAATAAATGGTACACTTGCTAGTTTTTCTAAAGGCATTGGAGCTCATTT
TATTGTTGAAAAAGATGGTAATATATACCAGGCTGCAAGCCTATTTGTATATACCAGCCATGTGGGGAAGATAAAGTCTC
GATGTAAGGAGGAAAAAACATGGTCGTCTGAAGAAAAAAAGAAAATAGAGGCATTCGGATGGAATGCTAAGAAGATACAT
GATCATGAAAAAATTAAACAATATCCTTATAGATATCCATATAATATGGACAGTGTTGGCATTGAGGTTATTGCATTATA
TGATAAAAAAAATAAAAAATGGGAGTCTGCTACAGACTCTCAAAAAAAATCAATTGAGAAACTTGTAGATATAATAAAAA
TATTTATGAGTTAG