Detailed information of immunity protein


Summary

Immunity protein ID IMU00313 experimental
Cognate effector EFF01465 experimental
Related T6SS (Type) T6SS00463 experimental (Type i2)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (226 a.a.); Nucleotide sequence (678 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_4535 (Tli1EAEC)
Coordinates (Strand) 4867307..4867984 (+)
NCBI ID 446118504
RefSeq NC_017626
Uniprot ID B7LFU3_ECO55, D3GUW6_ECO44
KEGG ID eck:EC55989_3329, elo:EC042_4535
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF2931 PF11153.10 9.4e-33 37..223

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-225 MTRDKIIFIAPLLALLTGCNSVSSRYADLDKTEWGYKKLPYDEWKFLFIYPKALPALATQALMVDGEGYKTTYQYLDNTEPSQVSVGRWNDHLGATESYYNKGKALPLMLRFCWDSIIDKKSYETLIFFKKGTWEQMVTPYADNRWNETYYRSTMIIGLAPEGKVRVWLGDRGNPVVPQLDAKITTVSGDKMKMCKGVTKSDFSYGYDEDIKEFIRDKTYPYGNW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9989 pos: 18-19. LTG-CN. MTRDKIIFIAPLLALLTG



  Protein sequence: 226 a.a.    .

>IMU00313 NC_017626:4867307-4867984 [Escherichia coli 042]
MTRDKIIFIAPLLALLTGCNSVSSRYADLDKTEWGYKKLPYDEWKFLFIYPKALPALATQALMVDGEGYKTTYQYLDNTE
PSQVSVGRWNDHLGATESYYNKGKALPLMLRFCWDSIIDKKSYETLIFFKKGTWEQMVTPYADNRWNETYYRSTMIIGLA
PEGKVRVWLGDRGNPVVPQLDAKITTVSGDKMKMCKGVTKSDFSYGYDEDIKEFIRDKTYPYGNW*

  Nucleotide sequence: 678 bp    .

>IMU00313 NC_017626:4867307-4867984 [Escherichia coli 042]
ATGACCAGAGATAAAATCATTTTTATCGCACCATTATTGGCATTGTTAACTGGGTGTAATTCGGTTAGCTCACGGTATGC
TGATTTGGATAAGACTGAATGGGGTTATAAAAAATTACCCTATGATGAATGGAAATTTCTCTTTATTTATCCAAAGGCTC
TGCCTGCGCTGGCCACCCAGGCGTTGATGGTGGACGGGGAAGGTTATAAGACGACTTATCAGTATCTTGATAATACCGAG
CCGAGTCAGGTCAGTGTAGGGCGCTGGAATGACCATCTGGGCGCGACTGAGTCGTATTATAACAAGGGGAAAGCATTACC
CCTGATGTTGCGTTTTTGCTGGGATTCAATAATTGATAAAAAGAGTTATGAAACTCTGATTTTTTTTAAAAAAGGGACCT
GGGAGCAGATGGTTACGCCTTACGCAGACAACCGCTGGAACGAAACCTATTATCGTTCAACGATGATTATTGGTCTGGCT
CCTGAAGGGAAGGTAAGAGTCTGGCTGGGAGATCGCGGTAATCCGGTGGTACCTCAGTTGGATGCTAAAATTACTACAGT
ATCGGGTGATAAAATGAAGATGTGTAAGGGGGTTACTAAAAGTGATTTCTCATATGGATATGATGAAGATATTAAGGAGT
TTATCAGAGATAAAACTTATCCTTACGGTAACTGGTGA