Detailed information of effector


Summary

Effector ID EFF01465 experimental
Effector type Tle
Cognate immunity protein IMU00313 experimental
Related T6SS (Type) T6SS00931 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (561 a.a.); Nucleotide sequence (1683 bp)
Description Tle1EAEC
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_RS24220
Coordinates (Strand) 4865605..4867287 (+)
NCBI ID 284924255
RefSeq NC_017626
Uniprot ID D3GUW5_ECO44
KEGG ID elo:EC042_4534
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF2235 PF09994.11 6.4e-10 233..320
DUF2235 PF09994.11 4.7e-06 114..210

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-560 MTKYQGYDVTDATHKTSIHNDWKVVVAKKKPARGVTLTIGIFFDGTGNNRENTASRLMKFNECSAARQGVNQKDAQSCEDFLKEINKNSISNGSYRGYYSNIHWLNILYHPDQVLKKDQTSAQIKTYISGIGTAAGEADSVIGMGLGTSILDIFEGVVTKTDEAMERITQALSEFMGFNLSPDFCIAKIQFDVFGFSRGAAAARHFANRVMEQDPAIARAIAKGLRGDFYDGKPSGEVRFLGLFDTVAAIGGISNFFDINGRSNPGVKLELRPSVAKKVFQITAMNEYRYNFSLNSIKGMWPELALPGAHSDIGGGYNPVGSPLQENESLFLSCPEFEIVSDDTREMDTRVYRKAEQVRKMLMTLPALKHILPHGKLTTKIRSIGVNNSNQRRAGVIQKQVGAAVFFERMAVPNDWANVCLRVMLDAAQEAGVLFEPIRQTNTELQLPSELIFLADKAIAQGKAVRLGQEPQAFTEEELYIIGKYTHCSANWNIESDGNLWVDPTTGEIFIHRFGPKGNKAFVFPNKPNDRWIRSVWYMDDQQRLNDNAVKNTKVMMSGV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9863 - -



  Protein sequence: 561 a.a.    .

>EFF01465 NC_017626:4865605-4867287 [Escherichia coli 042]
MTKYQGYDVTDATHKTSIHNDWKVVVAKKKPARGVTLTIGIFFDGTGNNRENTASRLMKFNECSAARQGVNQKDAQSCED
FLKEINKNSISNGSYRGYYSNIHWLNILYHPDQVLKKDQTSAQIKTYISGIGTAAGEADSVIGMGLGTSILDIFEGVVTK
TDEAMERITQALSEFMGFNLSPDFCIAKIQFDVFGFSRGAAAARHFANRVMEQDPAIARAIAKGLRGDFYDGKPSGEVRF
LGLFDTVAAIGGISNFFDINGRSNPGVKLELRPSVAKKVFQITAMNEYRYNFSLNSIKGMWPELALPGAHSDIGGGYNPV
GSPLQENESLFLSCPEFEIVSDDTREMDTRVYRKAEQVRKMLMTLPALKHILPHGKLTTKIRSIGVNNSNQRRAGVIQKQ
VGAAVFFERMAVPNDWANVCLRVMLDAAQEAGVLFEPIRQTNTELQLPSELIFLADKAIAQGKAVRLGQEPQAFTEEELY
IIGKYTHCSANWNIESDGNLWVDPTTGEIFIHRFGPKGNKAFVFPNKPNDRWIRSVWYMDDQQRLNDNAVKNTKVMMSGV
*

  Nucleotide sequence: 1683 bp    .

>EFF01465 NC_017626:4865605-4867287 [Escherichia coli 042]
ATGACAAAATATCAGGGATATGACGTAACAGATGCCACCCATAAAACCAGTATTCATAATGACTGGAAAGTTGTTGTTGC
AAAGAAAAAACCGGCGCGGGGTGTGACTTTAACTATTGGCATATTTTTCGATGGTACCGGAAACAATCGGGAGAATACAG
CATCTCGCCTGATGAAATTTAATGAGTGTAGTGCAGCCAGACAGGGGGTAAATCAAAAAGATGCACAAAGCTGTGAGGAC
TTTCTTAAAGAAATTAACAAGAACAGTATCTCGAATGGCAGTTATCGTGGATATTATTCCAATATTCACTGGCTTAATAT
ACTCTATCATCCAGATCAGGTACTTAAAAAAGACCAGACGTCAGCTCAAATTAAGACTTACATTTCCGGGATAGGGACTG
CGGCTGGTGAAGCAGATTCAGTCATAGGCATGGGATTAGGCACCAGTATTCTGGATATATTTGAAGGTGTGGTGACGAAA
ACCGACGAGGCAATGGAACGAATCACCCAGGCGTTATCAGAATTTATGGGGTTCAATTTAAGTCCTGATTTTTGTATCGC
AAAAATCCAGTTTGATGTTTTTGGTTTTAGCCGGGGAGCAGCGGCGGCAAGGCACTTTGCCAATCGGGTTATGGAACAGG
ATCCTGCTATAGCCAGAGCTATTGCTAAAGGGCTCAGAGGCGATTTTTATGATGGTAAACCTTCTGGTGAAGTACGTTTT
CTGGGGCTTTTTGATACTGTCGCAGCTATTGGTGGAATCAGTAATTTCTTCGATATTAATGGACGTAGCAACCCGGGAGT
AAAGCTGGAGTTGCGTCCTTCAGTCGCGAAGAAAGTTTTCCAGATTACTGCAATGAATGAATACCGATATAATTTCAGCC
TGAACAGTATTAAAGGTATGTGGCCCGAACTGGCTTTACCGGGGGCGCATTCAGATATTGGAGGTGGTTACAATCCGGTA
GGTTCACCTCTGCAGGAAAATGAAAGTCTGTTTCTGAGTTGCCCGGAATTTGAAATTGTCAGTGACGATACCAGAGAAAT
GGATACGCGAGTATACCGTAAAGCAGAGCAAGTCAGAAAAATGTTGATGACTCTGCCAGCCTTAAAACATATTTTGCCTC
ATGGAAAACTAACCACCAAAATTCGTTCCATAGGTGTGAACAACAGCAATCAACGTCGGGCTGGTGTGATACAAAAGCAG
GTGGGAGCCGCAGTATTTTTTGAGCGTATGGCAGTACCTAATGACTGGGCTAATGTTTGCCTGCGTGTGATGCTGGATGC
TGCTCAGGAAGCAGGGGTATTGTTTGAACCAATTCGACAAACAAATACTGAGTTACAACTTCCATCTGAACTAATATTTC
TTGCTGACAAAGCCATTGCTCAGGGAAAAGCGGTACGTTTGGGGCAAGAGCCTCAGGCTTTTACTGAGGAAGAGTTGTAT
ATTATCGGAAAATACACCCATTGTTCCGCTAACTGGAATATTGAGTCTGATGGTAATTTATGGGTGGATCCTACAACGGG
AGAGATTTTTATCCATCGCTTTGGTCCTAAAGGTAATAAGGCGTTCGTTTTTCCGAATAAACCAAATGATCGCTGGATTC
GTTCTGTATGGTACATGGATGATCAGCAGCGATTGAATGATAACGCAGTAAAAAATACTAAAGTTATGATGTCTGGTGTT
TAA