Detailed information of immunity protein


Summary

Immunity protein ID IMU00306 experimental
Cognate effector EFF01485 experimental
Related T6SS (Type) T6SS00312 experimental (Type i4b)
Strain Acinetobacter baumannii AB307-0294
Replicon chromosome
Sequence Protein sequence (326 a.a.); Nucleotide sequence (978 bp)
Description Expression of rhs2-CT alone in E. coli resulted in rapid arrest of E. coli growth . Coexpression of rhs2-CT with the predicted cognate immunity gene rhs2I did not result in growth at WT levels, but viable-cell counts performed 2 h after the induction of effector and immunity expres- sion revealed approximately 1,000-fold more viable cells than when the effector gene rhs2-CT was expressed alone.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ABBFA_02274 (Rhs2I)
Coordinates (Strand) 2458460..2459437 (-)
NCBI ID 447056300
RefSeq NZ_CP001172
Uniprot ID A0A0J0ZZ61_ACIBA, A0A2S4T1G2_9GAMM, A0A077GLH0_ACIBA, A0A0R4J8A9_ACIBY
KEGG ID aby:ABAYE2492
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
SIS PF01380.24 3.5e-27 41..172
CBS PF00571.30 1.7e-11 269..322
CBS PF00571.30 1.5e-06 201..258

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-325 MPNPTDFQSSALATLRIEQQAIDVLATQIDDRFNRACEILLQCKGRVVITGMGKSGHIGRKMAATFASTGTPSFFMHPGEAGHGDLGMLVRGDVLIAISNSGKSDEIMMLMPLIKHLGVPLITISRDDKGPMPQNADIALTLGESDEACPLGLAPTSSTTATLVLGDALAVALLEARGFTADDFARSHPAGALGKRLLLHVKHLMHTGEELPKVSPDTPMNQVLYEISNKRLGLTTIVDEQDHLLGIFTDGDLRRLIDKQQGFDVNLPVSEVMTKKPSTISQEARAVEALQQLNQKKISQFVVVDDQNKVIGVISMHDLIQAGVN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9610 - -



  Protein sequence: 326 a.a.    .

>IMU00306 NZ_CP001172:c2459437-2458460 [Acinetobacter baumannii AB307-0294]
MPNPTDFQSSALATLRIEQQAIDVLATQIDDRFNRACEILLQCKGRVVITGMGKSGHIGRKMAATFASTGTPSFFMHPGE
AGHGDLGMLVRGDVLIAISNSGKSDEIMMLMPLIKHLGVPLITISRDDKGPMPQNADIALTLGESDEACPLGLAPTSSTT
ATLVLGDALAVALLEARGFTADDFARSHPAGALGKRLLLHVKHLMHTGEELPKVSPDTPMNQVLYEISNKRLGLTTIVDE
QDHLLGIFTDGDLRRLIDKQQGFDVNLPVSEVMTKKPSTISQEARAVEALQQLNQKKISQFVVVDDQNKVIGVISMHDLI
QAGVN*

  Nucleotide sequence: 978 bp    .

>IMU00306 NZ_CP001172:c2459437-2458460 [Acinetobacter baumannii AB307-0294]
ATGCCTAATCCTACAGATTTCCAAAGCAGTGCATTAGCGACATTGCGCATTGAGCAACAAGCCATAGATGTATTAGCAAC
ACAAATTGATGACCGTTTTAATCGTGCTTGTGAAATATTATTACAATGCAAAGGTCGTGTTGTGATCACGGGTATGGGTA
AATCTGGGCATATTGGCCGAAAAATGGCAGCGACATTTGCTTCGACAGGCACGCCGTCTTTCTTTATGCATCCTGGCGAA
GCAGGGCATGGCGATTTAGGAATGCTGGTTCGTGGCGATGTACTTATTGCAATTTCCAACTCGGGAAAAAGCGATGAAAT
CATGATGTTGATGCCACTCATTAAGCATCTTGGTGTACCTCTTATTACGATTAGTCGTGATGATAAAGGCCCAATGCCGC
AAAATGCAGATATTGCTTTAACTCTGGGTGAGTCTGACGAAGCATGCCCTTTAGGTTTAGCGCCTACTTCAAGTACGACA
GCGACTTTGGTTTTAGGCGATGCTTTAGCAGTTGCTTTACTTGAAGCTCGTGGTTTTACTGCTGATGACTTTGCTCGTTC
GCATCCGGCAGGTGCGTTGGGTAAGCGTTTACTGTTACATGTAAAACATTTAATGCATACAGGCGAAGAGTTACCAAAAG
TTTCACCTGATACACCAATGAATCAAGTACTTTACGAGATCTCAAATAAGCGTTTAGGCTTGACAACAATTGTTGATGAA
CAAGACCATCTACTTGGTATTTTTACAGATGGGGATTTACGTCGTCTCATCGATAAACAGCAAGGGTTTGATGTAAATTT
ACCTGTGTCTGAAGTGATGACAAAGAAACCGTCAACGATCTCTCAAGAAGCACGAGCTGTAGAAGCTTTACAACAACTTA
ACCAGAAAAAAATCAGTCAGTTTGTAGTAGTCGATGACCAGAACAAAGTGATTGGTGTAATTAGTATGCATGACCTTATT
CAGGCAGGGGTGAATTAA