Detailed information of effector


Summary

Effector ID EFF01485 experimental
Effector type Tde
Cognate immunity protein IMU00306 experimental
Related T6SS (Type) T6SS00312 experimental (Type i4b)
Strain Acinetobacter baumannii AB307-0294
Replicon chromosome
Sequence Protein sequence (474 a.a.); Nucleotide sequence (1422 bp)
Description Rhs2 contained an AHH (alanine-histidine-histidine) motif within the C-terminal region that is characteristic of AHH superfamily nucleases.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ABBFA_RS11575
Coordinates (Strand) 2459651..2461072 (+)
NCBI ID 447105016
RefSeq NZ_CP001172
Uniprot ID A0A0J1A0A3_ACIBA, A0A0D5YJE0_ACIBA, SYC_ACIB5, SYC_ACIBY, SYC_ACIB3
KEGG ID aby:ABAYE2493, abn:AB57_1408
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
tRNA-synt_1e PF01406.21 1.7e-132 18..317
DALR_2 PF09190.13 1.3e-19 349..411

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-473 MQPFVLYNSEQRKKVEFVPRKEGHIDMYVCGMTVYDYCHIGHARVMVAFDYIIRFLRSQGWKVRYIRNITDIDDKIIKRANENGETIQQLTTRFIDAMNEDAANLGCLAPDEAPKATEYIDQMQNMIGNLVNKGAAYPASNGDVYFEVTKFEKYGRLSGRKLDDMQAGASERIDVEVEKKHPFDFVLWKHAKENEPSWASPWGNGRPGWHIECSAMSTCCLGNHFDIHGGGSDLMFPHHENEIAQSEASTGEQYVNYWMHVGFINVDGEKMSKSLGNFFTIRDVMEKFHPEVIRYFIVSSHYRSPVNFSDVALKEAKTSLTRFYHSFKAYQQVYGQTTTEALDQSFIERFNNAMCDDFNTAEAMAVLFELNKELNRAVKEEQADQATVLYSTLRHLTNILGLVQHNVDDFLKSDIGQDALALSDAEIEDFIQQRVDAKKAKDFAKADSIRQSLLEQGVVLEDTRQGTVWRRAD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9922 - -



  Protein sequence: 474 a.a.    .

>EFF01485 NZ_CP001172:2459651-2461072 [Acinetobacter baumannii AB307-0294]
MQPFVLYNSEQRKKVEFVPRKEGHIDMYVCGMTVYDYCHIGHARVMVAFDYIIRFLRSQGWKVRYIRNITDIDDKIIKRA
NENGETIQQLTTRFIDAMNEDAANLGCLAPDEAPKATEYIDQMQNMIGNLVNKGAAYPASNGDVYFEVTKFEKYGRLSGR
KLDDMQAGASERIDVEVEKKHPFDFVLWKHAKENEPSWASPWGNGRPGWHIECSAMSTCCLGNHFDIHGGGSDLMFPHHE
NEIAQSEASTGEQYVNYWMHVGFINVDGEKMSKSLGNFFTIRDVMEKFHPEVIRYFIVSSHYRSPVNFSDVALKEAKTSL
TRFYHSFKAYQQVYGQTTTEALDQSFIERFNNAMCDDFNTAEAMAVLFELNKELNRAVKEEQADQATVLYSTLRHLTNIL
GLVQHNVDDFLKSDIGQDALALSDAEIEDFIQQRVDAKKAKDFAKADSIRQSLLEQGVVLEDTRQGTVWRRAD*

  Nucleotide sequence: 1422 bp    .

>EFF01485 NZ_CP001172:2459651-2461072 [Acinetobacter baumannii AB307-0294]
ATGCAACCGTTTGTTTTATATAACTCTGAGCAACGAAAAAAAGTTGAATTTGTACCTCGCAAAGAAGGTCACATCGATAT
GTACGTCTGCGGTATGACCGTTTACGACTACTGTCATATCGGGCATGCTCGAGTTATGGTTGCATTTGACTACATTATCC
GTTTTTTGCGTAGTCAAGGCTGGAAAGTCCGCTACATTCGCAACATTACCGATATCGATGACAAAATCATCAAACGTGCG
AATGAGAATGGTGAAACAATCCAACAGCTCACCACGCGTTTCATCGATGCCATGAATGAAGATGCAGCGAACTTAGGCTG
TTTAGCACCAGATGAAGCACCTAAAGCGACTGAATATATTGACCAGATGCAAAATATGATTGGTAATCTGGTAAATAAAG
GCGCTGCTTACCCTGCTTCAAACGGTGATGTGTATTTTGAAGTCACCAAATTTGAAAAATATGGACGTCTCTCTGGCCGT
AAGCTTGATGACATGCAAGCTGGCGCAAGTGAGCGTATTGATGTAGAAGTTGAAAAGAAACATCCTTTTGACTTTGTGCT
TTGGAAACATGCAAAAGAAAATGAACCGTCTTGGGCATCCCCTTGGGGTAATGGTCGTCCGGGTTGGCACATTGAATGTT
CTGCAATGTCGACTTGCTGCCTAGGCAATCACTTTGACATTCATGGTGGCGGTTCAGATTTAATGTTCCCGCACCATGAA
AATGAAATTGCGCAAAGTGAAGCTTCGACTGGTGAGCAATATGTAAACTACTGGATGCATGTTGGCTTTATTAACGTTGA
TGGTGAAAAGATGTCTAAGTCTTTAGGCAACTTCTTTACGATTCGTGACGTAATGGAGAAATTCCACCCAGAAGTGATTC
GATACTTCATTGTGTCTTCACACTATCGTAGCCCTGTGAACTTCTCTGATGTAGCACTTAAAGAGGCAAAAACTTCTTTA
ACTCGTTTCTATCATTCATTTAAAGCTTACCAACAAGTGTACGGTCAAACGACAACTGAAGCGCTTGATCAAAGCTTTAT
TGAACGCTTTAACAATGCAATGTGTGACGATTTCAATACTGCCGAAGCAATGGCTGTATTGTTTGAACTGAACAAAGAGT
TAAACCGTGCTGTAAAAGAAGAGCAAGCTGACCAAGCGACTGTGCTTTATTCGACATTACGTCACCTCACCAACATTTTA
GGTTTGGTACAACACAATGTAGACGATTTCTTAAAATCAGATATTGGACAAGATGCACTTGCTTTGTCTGATGCTGAAAT
TGAAGATTTCATTCAACAACGTGTTGATGCGAAAAAAGCAAAAGACTTTGCTAAAGCAGATAGCATTCGTCAGTCTTTAC
TTGAGCAAGGCGTAGTTCTTGAAGACACTCGTCAAGGTACAGTTTGGCGTCGTGCTGATTAA