Detailed information of immunity protein


Summary

Immunity protein ID IMU00305 experimental
Cognate effector EFF01484 experimental
Related T6SS (Type) T6SS00312 experimental (Type i4b)
Strain Acinetobacter baumannii AB307-0294
Replicon chromosome
Sequence Protein sequence (288 a.a.); Nucleotide sequence (864 bp)
Description Expression of rhs1-CT alone within the cytoplasm of E. coli resulted in the arrest of E. coli growth within 1 h following induction of expression. E. coli expressing both rhs1-CT and the predicted cognate immunity gene, rhs1I, grew at normal WT levels, confirming that Rhs1 and Rhs1I are a genuine effector-immunity pair.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ABBFA_02467 (Rhs1I)
Coordinates (Strand) 2669468..2670331 (-)
NCBI ID 446971646
RefSeq NZ_CP001172
Uniprot ID A0A009Q8T9_ACIBA, A0A009IIV5_ACIB9, A0A0J0ZK46_ACIBA, A0A086HY23_ACIBA, B0VA96_ACIBY, D0CDX8_ACIB2
KEGG ID aby:ABAYE2667
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Abhydrolase_3 PF07859.15 1.4e-14 71..151

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-287 MNLIEQLQSKIEQARTLYKEFRLYDLGSFALNRFTPKDGFEQVLNVRYGLKPRHRLDIYRSTKRLAHRPLIVFVHGGAWQHGNKRDYLFIGEAFTKEGYDVAVINYQLAPKNIFPSYVDDLTQALNYLHQNQEKLEISTENIVLMGHSAGAFNVMSAVYHPKPNTIQCLGNIKAIFGLAGPYHFDYKGDPLAEDAFDQSISYKEVMPYYFVNQNHIKHYLLMAENDQLVKKENTFDLDQALRQSGNHSHIAVIPKTGHITILASLSSFVSHYFRTKRTILHFLDEVF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9955 - -



  Protein sequence: 288 a.a.    .

>IMU00305 NZ_CP001172:c2670331-2669468 [Acinetobacter baumannii AB307-0294]
MNLIEQLQSKIEQARTLYKEFRLYDLGSFALNRFTPKDGFEQVLNVRYGLKPRHRLDIYRSTKRLAHRPLIVFVHGGAWQ
HGNKRDYLFIGEAFTKEGYDVAVINYQLAPKNIFPSYVDDLTQALNYLHQNQEKLEISTENIVLMGHSAGAFNVMSAVYH
PKPNTIQCLGNIKAIFGLAGPYHFDYKGDPLAEDAFDQSISYKEVMPYYFVNQNHIKHYLLMAENDQLVKKENTFDLDQA
LRQSGNHSHIAVIPKTGHITILASLSSFVSHYFRTKRTILHFLDEVF*

  Nucleotide sequence: 864 bp    .

>IMU00305 NZ_CP001172:c2670331-2669468 [Acinetobacter baumannii AB307-0294]
ATGAACCTGATTGAACAATTACAAAGCAAAATTGAGCAGGCGAGAACTCTTTATAAAGAGTTCCGTCTGTATGATTTGGG
GAGCTTTGCTTTAAACCGTTTTACACCAAAAGATGGTTTTGAGCAGGTTTTAAATGTGCGTTATGGCTTAAAGCCTCGCC
ATCGTCTAGATATTTATCGTTCTACTAAGCGCTTAGCTCATCGACCACTCATTGTTTTTGTACATGGTGGTGCTTGGCAA
CATGGTAATAAACGAGACTATTTATTTATAGGTGAAGCGTTTACGAAAGAAGGTTATGACGTTGCTGTCATTAACTATCA
GCTCGCACCGAAGAATATTTTTCCAAGTTATGTAGATGACTTAACGCAAGCGTTAAACTATTTACACCAGAACCAAGAAA
AACTGGAAATCTCGACAGAGAATATTGTGCTTATGGGGCATTCGGCAGGTGCATTTAATGTGATGTCTGCTGTTTATCAC
CCAAAACCAAATACAATTCAGTGTTTAGGTAATATTAAAGCAATTTTTGGTTTGGCAGGTCCTTATCATTTTGATTATAA
AGGTGATCCGCTTGCCGAAGATGCTTTTGATCAAAGCATTTCTTATAAAGAAGTGATGCCATATTATTTTGTAAATCAAA
ATCATATTAAGCATTATCTGCTCATGGCTGAAAATGATCAGCTTGTAAAAAAAGAAAATACCTTTGATCTTGATCAGGCA
CTTAGACAAAGCGGAAATCACAGTCATATCGCTGTGATTCCTAAAACAGGTCATATTACAATTTTGGCGAGTTTATCGAG
TTTTGTAAGTCATTACTTCCGAACTAAACGGACCATTTTGCACTTTCTGGATGAAGTATTCTAA