Detailed information of effector


Summary

Effector ID EFF01484 experimental
Effector type Tde
Cognate immunity protein IMU00305 experimental
Related T6SS (Type) T6SS00312 experimental (Type i4b)
Strain Acinetobacter baumannii AB307-0294
Replicon chromosome
Sequence Protein sequence (236 a.a.); Nucleotide sequence (708 bp)
Description Rhs1 shares amino acid identity with several previously characterized T6SS Rhs family nuclease effectors.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ABBFA_RS12570
Coordinates (Strand) 2670335..2671042 (-)
NCBI ID 446842107
RefSeq NZ_CP001172
Uniprot ID A0A009PDZ0_ACIBA, A0A009HNH4_ACIB9, A0A009GXB3_ACIBA, A0A0E1PSS2_ACIBA, A0A0J1CU63_ACIBA, A0A2S4T6C1_9GAMM, B0VA97_ACIBY, D0CDX7_ACIB2, L9MAV6_9GAMM
KEGG ID aby:ABAYE2668
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
BON PF04972.19 6.8e-11 60..113

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-235 VLKRIAVTALCVASLSGCASFISGGTGTAPVGTDSGVRSLGQVFIDSSIKRTANINLYKLDQRFKQSRINIESFHSTVLLTGQVPDPYLKQLAEDNVKAMSDVKAVHNYITVGNKVSYNTIMQDAGVTANTRALLMKAPVVSDSKVLVHTEDGVLYVMGRLNTAEINDLNNVLQNVGNVTKIVTLIDNIDLAPAPAASTASATTTPVINNVLAQPTVQTPVAIDPDQTDPASSAQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9953 pos: 17-18. LSG-CA. VLKRIAVTALCVASLSG



  Protein sequence: 236 a.a.    .

>EFF01484 NZ_CP001172:c2671042-2670335 [Acinetobacter baumannii AB307-0294]
VLKRIAVTALCVASLSGCASFISGGTGTAPVGTDSGVRSLGQVFIDSSIKRTANINLYKLDQRFKQSRINIESFHSTVLL
TGQVPDPYLKQLAEDNVKAMSDVKAVHNYITVGNKVSYNTIMQDAGVTANTRALLMKAPVVSDSKVLVHTEDGVLYVMGR
LNTAEINDLNNVLQNVGNVTKIVTLIDNIDLAPAPAASTASATTTPVINNVLAQPTVQTPVAIDPDQTDPASSAQ*

  Nucleotide sequence: 708 bp    .

>EFF01484 NZ_CP001172:c2671042-2670335 [Acinetobacter baumannii AB307-0294]
GTGTTGAAACGTATTGCTGTAACAGCGCTTTGTGTCGCAAGTTTGTCAGGTTGCGCAAGTTTTATTTCTGGTGGAACAGG
TACAGCTCCAGTTGGAACAGATAGTGGTGTACGTAGCTTAGGCCAAGTATTTATTGATTCTTCAATTAAGCGTACAGCGA
ATATTAACCTCTATAAGCTTGATCAGCGTTTTAAACAATCTCGTATTAACATCGAAAGCTTCCATAGCACAGTATTGTTA
ACTGGACAGGTGCCAGACCCATACTTAAAACAGTTGGCAGAAGACAACGTTAAAGCCATGAGTGATGTGAAAGCTGTACA
TAACTACATTACCGTGGGTAACAAAGTAAGCTATAACACGATTATGCAAGATGCTGGGGTAACCGCAAATACACGTGCTT
TATTAATGAAAGCGCCAGTAGTATCGGACAGTAAAGTACTGGTTCATACCGAAGATGGTGTTTTATATGTGATGGGCCGT
TTAAACACAGCTGAAATTAATGATTTAAACAATGTGCTTCAAAATGTCGGTAACGTGACTAAGATTGTAACGCTCATTGA
TAATATTGATTTAGCGCCTGCTCCGGCAGCGAGTACTGCCAGCGCAACAACTACACCAGTAATTAATAACGTTCTTGCTC
AACCAACAGTTCAAACTCCTGTTGCAATTGATCCGGACCAAACAGATCCAGCATCTTCTGCACAATAA