Detailed information of immunity protein


Summary

Immunity protein ID IMU00291 experimental
Cognate effector EFF01442 experimental
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (76 a.a.); Nucleotide sequence (228 bp)
Description TsiH
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VC_RS14695
Coordinates (Strand) 305996..306223 (+)
NCBI ID 15601052
RefSeq NC_002506
Uniprot ID Q9KMN8_VIBCH
KEGG ID vch:VC_A0286
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-75 MIWFPEPTATGLSIVENKHPIYTIRITCGSPDNICHEGLFEYKGNTLSKIEIRDFASYLGEEITLTNGETLEPMN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9150 - -



  Protein sequence: 76 a.a.    .

>IMU00291 NC_002506:305996-306223 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIWFPEPTATGLSIVENKHPIYTIRITCGSPDNICHEGLFEYKGNTLSKIEIRDFASYLGEEITLTNGETLEPMN*

  Nucleotide sequence: 228 bp    .

>IMU00291 NC_002506:305996-306223 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGATTTGGTTCCCAGAGCCCACAGCAACGGGTCTCAGTATTGTAGAGAATAAACATCCTATCTATACGATTCGTATAAC
GTGTGGCTCTCCGGATAATATTTGCCATGAAGGCCTATTTGAGTACAAAGGGAACACACTAAGCAAAATTGAGATAAGAG
ATTTTGCTAGCTATTTAGGTGAAGAAATCACCTTAACGAATGGTGAAACCTTAGAACCTATGAATTGA