Detailed information of effector


Summary

Effector ID EFF01442 experimental
Effector type Tae
Cognate immunity protein IMU00291 experimental
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (224 a.a.); Nucleotide sequence (672 bp)
Description TseH
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCA0285
Coordinates (Strand) 305200..305871 (+)
NCBI ID 15601051
RefSeq NC_002506
Uniprot ID Q9KMN9_VIBCH
KEGG ID vch:VCA0285
PDB ID 6V98

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-223 MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILINGETGVTRYYEYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRGKFFSEADSWLRGKMDLNNSPDKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDLDYDYKTNKLTVSE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9894 - -



  Protein sequence: 224 a.a.    .

>EFF01442 NC_002506:305200-305871 [Vibrio cholerae O1 biovar El Tor str. N16961]
MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILINGETGVTRYY
EYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRGKFFSEADSWLRGKMDLNNSP
DKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDLDYDYKTNKLTVSE*

  Nucleotide sequence: 672 bp    .

>EFF01442 NC_002506:305200-305871 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGACTGACACTGTATCATCAACTCCAGTAGCCGATACAACTCCATATGAGATATTTCTTTCAGGTAATGACGATTTTTT
GATACCTGTAGTATTTCCTGACTACCTAATCTCAGTCGCAGATGAACAATCTTTTGAGTTATGGGGTGTAAAAATAAAAA
CTCCTGCAGTGAAGGCCCCCTACCTTGGTCACGCTGGAGTTATTTTGATTAATGGTGAAACAGGTGTTACTCGCTATTAT
GAGTATGGCCGTTACAAGAACCCTAAATCGGATATCCCAGGAAATGTGAGGAAGGTTGGGGTATCAAATGTAACTATAAA
AAGTGGTCTAATTACTGAAAGCTCGTTACTGAAGGTTCTTAAAGAAGTGTCCCTACGTTCTGGACAGGAGGGGAGAATTT
CGGGAGTGGTATTAAGAGGAAAGTTTTTCTCTGAAGCAGATTCATGGTTAAGGGGAAAAATGGATCTTAATAATAGCCCT
GATAAGATACCTTATGACTTGGATAGCCATAACTGCATGACATTTGTCATAGATTTAGCTGATGCAATGGGGTTAGACCC
GGCTTGGAAACCTCCTGTTGTTGTACCAAGCGCGTATATTGAACAGTTTCAGTTAAGTGAAATTGATTTAGATTATGACT
ATAAGACCAACAAATTAACGGTATCTGAGTGA