Detailed information of immunity protein


Summary

Immunity protein ID IMU00272 experimental
Cognate effector EFF01011 experimental
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (123 a.a.); Nucleotide sequence (369 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS00985
Coordinates (Strand) 201656..202024 (-)
NCBI ID WP_001061295.1
RefSeq NZ_KQ410497
Uniprot ID TSIV3_VIBCH, A0A023PSF3_VIBCL, A0A0H3AF63_VIBC3, A0A0K9UWF2_VIBCL, A0A0X1L1W1_VIBCO, C3LUE8_VIBCM
KEGG ID vcx:VAA049_1784, vcm:VCM66_A0122, vch:VCA0124, vco:VC0395_0013
PDB ID 4NOO, 4NSR, 4NSO

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-3 MNN
Transmembrane helix 4-23 LLSAYVTMLLILLSISGGAI
Inside 24-122 ASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9771 pos: 24-25. AIA-SE. MNNLLSAYVTMLLILLSISGGAIA



  Protein sequence: 123 a.a.    .

>IMU00272 NZ_KQ410497:c202024-201656 [Vibrio cholerae V52]
MNNLLSAYVTMLLILLSISGGAIASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHE
KCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS*

  Nucleotide sequence: 369 bp    .

>IMU00272 NZ_KQ410497:c202024-201656 [Vibrio cholerae V52]
ATGAATAACTTGCTTTCTGCGTATGTAACTATGCTGTTGATATTATTAAGTATTAGTGGTGGCGCTATTGCTAGTGAAAA
CTGCAATGATACATCTGGAGTGCATCAAAAAATTCTAGTGTGTATCCAAAATGAGATAGCTAAGTCAGAGACTCAGATTA
GAAATAATATTTCTTCTAAGTCTATAGATTATGGCTTTCCTGATGATTTCTACAGCAAGCAAAGATTAGCTATTCATGAA
AAGTGTATGCTTTATATAAATGTCGGTGGCCAACGTGGTGAATTGCTAATGAACCAATGTGAACTTTCGATGCTACAAGG
CCTTGATATTTACATTCAACAGTATATAGAGGATGTTGATAATAGTTAG