Detailed information of effector


Summary

Effector ID EFF01011 experimental
Effector type -
Cognate immunity protein IMU00272 experimental
Related T6SS (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (1018 a.a.); Nucleotide sequence (3054 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS00990 (vgrG3)
Coordinates (Strand) 202021..205074 (-)
NCBI ID WP_000113305.1
RefSeq NZ_KQ410497
Uniprot ID UPI0000ED6B39
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 3e-70 41..334
Phage_base_V PF04717.14 5e-15 391..458
PG_binding_1 PF01471.20 4.4e-08 731..773
DUF2345 PF10106.11 9.7e-05 570..618

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1017 MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRSEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTILRDGQVVQQINGIVRQFSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSYLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKKPAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDLAMNRDWLVVQANHQGTQPQALQEEGGAGATTYSNQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQEWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETHQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHPSYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGNGDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFREEQHQFIKRTHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNMESMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9958 - -



  Protein sequence: 1018 a.a.    .

>EFF01011 NZ_KQ410497:c205074-202021 [Vibrio cholerae V52]
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRSEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTILRDGQVVQQIN
GIVRQFSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETD
LQFLHRIAAEEGLVYSYLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKK
PAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDLAMN
RDWLVVQANHQGTQPQALQEEGGAGATTYSNQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHF
PWDRYSSSNEKSSCWVRVAQEWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTE
THQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHE
VGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAA
APRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKR
QASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHPSYSIGAVDGIVGKGTLLALD
EALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGNGDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPAT
KEFNVVWQDIASRYPQEFREEQHQFIKRTHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNME
SMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK*

  Nucleotide sequence: 3054 bp    .

>EFF01011 NZ_KQ410497:c205074-202021 [Vibrio cholerae V52]
ATGGCAAGGTTACAGTTTCAATTAAAGGTGGATGGCCTTGAGGATGAATCCCTCGTCGTACGCGGATTTGAAGGGCAAGA
GTCCTTGTCTGATTCTGTATGGCGCAGTGAACCCTGCTATGGTTTTCGCTATCAGGTTGATTTAGCCAGTGCGCTAAGTA
ATCTCACGGCTGAGCAATTTGTAGACCAAACCGCACATTTAACCATTCTGCGTGACGGGCAAGTGGTGCAGCAAATAAAC
GGTATTGTGCGTCAATTCAGCAAAGGGGATACCGGCCATCGACATACTTTCTATTCATTAACGCTAGTTCCTGCGTTGGA
AAGGCTTTCTTTACGCAGTAATAGCCGTATTTTCCAGCAGCAAAGCGTGCCAGAGATTATCTCTATTTTACTGCAAGAGA
TGGGGATTGAAGATTACGCCTTTGCCCTTAAGCGTGAGTGTGCCCAGCGAGAGTTTTGTGTACAGTATCGTGAAACAGAT
TTGCAGTTTTTACACCGTATCGCCGCCGAAGAAGGTTTGGTTTACAGCTATCTACATGAAGCGCAGAAACACACCTTGCT
GTTTACCGATAGCTCGGACAGCCAACCGAAGTTAGCCAAGCCAGTACCTTATAATGCGCTGGCGGGTGGCGAGATCAATC
TCCCTTATGTGGTCGATCTGCAATTCAAGACCACCGCGCAAGTGAGCCATACCGAGCTAAAGGATTACAGCTTTAAAAAG
CCAGCTTACGGATTTACTCAGCGCACGCAGGGTAAAGATATCGCTTATCAGCAGCCAAATTATGAGCATTTTGATGCTCC
GGGACGCTACAAAGACGATGCAAATGGCAAGGCCTTTAGCCAAATTCGCTTAGAGTATTTACGCCGCGATGCTTTGCTTG
CTGATGCGAAGAGTGACGAACCTTTGCTGTTGGCGGGAGTGCGTTTTGACTTGCAAGATCACCTTGATCTCGCAATGAAT
CGAGATTGGCTCGTGGTACAAGCCAATCACCAAGGGACGCAGCCACAAGCGTTACAAGAAGAGGGGGGGGCAGGCGCTAC
CACTTACAGCAATCAGCTAAAACTTATCCCCGCTCACATCACTTGGCGAGCAAGGCCTTGTGCTAAGCCGCAAGTGGATG
GTCCCATGATCGCTACCGTAGTTGGGCCACAAGGTGAAGAGATTTATTGTGATAACTTTGGTCGCGTGAAAGTGCATTTC
CCGTGGGATCGCTACTCAAGTAGCAATGAGAAAAGCTCTTGCTGGGTACGAGTGGCACAAGAATGGGCGGGTAGCCAATA
CGGTAGTATGGCGATTCCGCGAGTCGGCCATGAAGTGATTGTTTCGTTCCTGAATGGCGATCCGGATCAACCCATCATCA
CGGGTCGTACGTACCATGCGACCAATACCGCGCCTTACGCCTTGCCTGACCACAAAACCAAAACCGTACTGCGAACTGAG
ACTCACCAAGGGCAAGGCTACAACGAACTGAGTTTTGAGGATCAAGCGGGCAGCGAACAGATTTTGCTGCATGCACAAAA
AGATTGGGATGCGTTGATTGAGCATGATCACACCGAAGTGATTCGCCACGATCAGCATCTCACTGTGGACAATGATCGCT
TTACCCGCATTCAGCGCAACCAACATTTAACGGTTGAAGGTGAAGTCCGTAGCAAAATCGCACTCGATAGCAGCCATGAA
GTCGGCGCGTCACTACAACACAAAGTAGGGCAACGCATTGCTGTCGAGGCGGGCAAAGAGATTTCACTCAAAAGCGGCGC
AAAAATCGTGGTTGAAGCCGGAGCGGAGTTAACCCTAAAAGCAGGGGGCAGCTTTGTAAAAGTCGATGCAGGTGGCGTGC
ACTTAGTCGGTCCTGCCATTAACCTAAACGCGGGCGGCAGTGCAGGCAGCGGTAGCGCTTATGGTGGGCAATTAGCCGCA
GCACCAAGAATGTTAGCGCAAGCTAAACCAGTAGCTGAATTGGTTCAGCCGGATATTGCTGCCTCAATGCAATCAGGCGC
GGCGCGTGTTATTGATGTGGCATCACTCCCCACAATGATGCCGAGTTCAGCCAATAACACGGCAAATGATGAGCCTGTGG
CCGAAGAGAAAACACCGGAGCGAATTTTAAAATCCGATCTCCTCAAACCATCCGATGAGTTAGAGAAACTCGCCAAGCGA
CAAGCGAGTGCTTATCGTCAAGGTAATCACAGCGATGAGGTTAAGTTACTACAAGAAGCGCTCATAAAATTGGGGTTTGA
TCTCGGGAAAGCAGGAGCTGATGGTGACTTTGGGAGCAAAACTAAAACCGCGATTGAGCAGTTCCAGAAAAGCTATCAAC
CAAGCCACCAAACCCACCCGTCTTACAGCATTGGCGCTGTTGACGGTATTGTCGGCAAAGGTACACTACTGGCACTAGAC
GAAGCCTTGATGGATGGGTGGGTGTATGAGAATAATATTTATCAAATATGGCCTCTAGGTAAAACGTCAGAGAAATATGA
GTCGGCAGGAAGAGGCCCAGGGGTTATATCAACAGGAAATGGAGATTATGGTGGGGCTTCATATGGTTGCTATCAAATGT
CATCAAATCTTGGTGTGGTACAAAAATATATTCAGTCATCAAAATTCAAAGAATTCTTTAGTGGATTAAATCCCGCTACG
AAAGAGTTTAATGTTGTTTGGCAGGATATAGCTTCAAGATATCCTCAGGAATTCAGAGAAGAACAACACCAATTTATTAA
GAGAACTCATTATGATATACAAATAGGACATCTTAGAGGGAAAGGACTTTTGTTTGAACATAATCGAGCTGCTGTACATG
ATTTGATCTGGTCTACTTCAGTACAGTTTGGTGGGAGAACTAATTTGATTTTCAATGCATTGAATGGACAAAATATGGAA
AGTATGACTGATAAGGACATCATTATTCTGGTACAAGATTACAAGCTTGTTAATACAGAAAGGCTTTTTAAGTCTTCGCC
ATCATGGTGGAGTGATTTAAAAAAACGTGCGGTATCAGAGAAAAAAGCTTTACTTGAACTAGAAATTGACGGTTTGGAGG
TTGATATAAAATGA