Detailed information of immunity protein


Summary

Immunity protein ID IMU00172 experimental
Cognate effector EFF00005 experimental
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (123 a.a.); Nucleotide sequence (369 bp)
Description TsiV3
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCA0124 (TsiV3)
Coordinates (Strand) 140631..140999 (+)
NCBI ID 15600895
RefSeq NC_002506
Uniprot ID TSIV3_VIBCH
KEGG ID vch:VC_A0124
PDB ID 4NOO, 4NSR, 4NSO

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-3 MNN
Transmembrane helix 4-23 LLSAYVTMLLILLSISGGAI
Inside 24-122 ASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9771 pos: 24-25. AIA-SE. MNNLLSAYVTMLLILLSISGGAIA



  Protein sequence: 123 a.a.    .

>IMU00172 NC_002506:140631-140999 [Vibrio cholerae O1 biovar El Tor str. N16961]
MNNLLSAYVTMLLILLSISGGAIASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHE
KCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS*

  Nucleotide sequence: 369 bp    .

>IMU00172 NC_002506:140631-140999 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGAATAACTTGCTTTCTGCGTATGTAACTATGCTGTTGATATTATTAAGTATTAGTGGTGGCGCTATTGCTAGTGAAAA
CTGCAATGATACATCTGGAGTGCATCAAAAAATTCTAGTGTGTATCCAAAATGAGATAGCTAAGTCAGAGACTCAGATTA
GAAATAATATTTCTTCTAAGTCTATAGATTATGGCTTTCCTGATGATTTCTACAGCAAGCAAAGATTAGCTATTCATGAA
AAGTGTATGCTTTATATAAATGTCGGTGGCCAACGTGGTGAATTGCTAATGAACCAATGTGAACTTTCGATGCTACAAGG
CCTTGATATTTACATTCAACAGTATATAGAGGATGTTGATAATAGTTAG