Detailed information of effector


Summary

Effector ID EFF00005 experimental
Effector type Tge
Cognate immunity protein IMU00172 experimental
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (1018 a.a.); Nucleotide sequence (3054 bp)
Description type VI secretion system Vgr family protein; Muramidase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCA0123
Coordinates (Strand) 137581..140634 (+)
NCBI ID 15600894
RefSeq NC_002506
Uniprot ID VGRG3_VIBCH
KEGG ID vch:VC_A0123
PDB ID 4NOO, 4NSO

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 4.6e-70 41..334
Phage_base_V PF04717.14 5e-15 391..458
PG_binding_1 PF01471.20 4.4e-08 731..773
DUF2345 PF10106.11 9.7e-05 570..618

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1017 MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTILRDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKKPAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYSNQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQEWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETHQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHPSYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGNGDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFREEQHQFIKRTHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNMESMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9951 - -



  Protein sequence: 1018 a.a.    .

>EFF00005 NC_002506:137581-140634 [Vibrio cholerae O1 biovar El Tor str. N16961]
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTILRDGQVVQQIN
GIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETD
LQFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKK
PAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDHAMN
RDWLVVQANHQGTQPQALQEEGGSGATTYSNQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHF
PWDRYSSSNEKSSCWVRVAQEWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTE
THQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHE
VGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAA
APRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKR
QASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHPSYSIGAVDGIVGKGTLLALD
EALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGNGDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPAT
KEFNVVWQDIASRYPQEFREEQHQFIKRTHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNME
SMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK*

  Nucleotide sequence: 3054 bp    .

>EFF00005 NC_002506:137581-140634 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGGCAAGGTTACAGTTTCAATTAAAGGTGGATGGCCTTGAGGATGAATCCCTCGTCGTACGCGGATTTGAAGGGCAAGA
GTCCTTGTCTGATTCTGTATGGCGCTGTGAACCCTGCTATGGTTTTCGCTATCAGGTTGATTTAGCCAGTGCGCTAAGCA
ACCTTACTGCTGAGCAATTTGTCGACCAAACCGCGCATTTAACCATTCTGCGTGACGGGCAAGTGGTGCAGCAAATTAAC
GGTATCGTACGCCAATTGAGTAAAGGCGATACTGGGCATCGGCACACGTTTTATTCTCTTACGTTAGTACCTGCGCTGGA
GCGGCTTTCTTTACGCAGTAATAGCCGTATTTTCCAGCAGCAAAGCGTGCCGGAAATTATCTCTATTTTACTGCAAGAGA
TGGGGATTGAAGATTACGCCTTTGCCCTTAAGCGTGAGTGTGCCCAGCGTGAGTTTTGTGTGCAGTACCGTGAAACGGAT
TTGCAGTTTTTACACCGTATCGCCGCCGAAGAAGGCTTGGTATACAGTCACCTACATGAAGCGCAGAAACACACGCTACT
GTTTACCGATAGCTCGGACAGCCAACCGAAGTTAGCCAAGCCAGTACCTTATAATGCGCTGGCGGGTGGCGAGATCAATC
TCCCTTATGTGGTCGATCTGCAATTCAAGACCACCGCACAAGTCAGCCATACCGAGCTAAAGGATTACAGCTTTAAAAAG
CCAGCTTACGGATTTACTCAGCGCACGCAGGGTAAAGATATCGCTTATCAGCAGCCAAATTATGAGCATTTTGATGCTCC
GGGACGCTACAAAGACGATGCAAATGGCAAGGCCTTTAGCCAAATTCGCTTAGAGTATTTACGTCGCGATGCTTTGCTTG
CTGATGCGAAGAGTGACGAACCTTTGCTGTTGGCGGGAGTGCGTTTTGACTTGCAAGATCACCTTGATCACGCAATGAAT
CGAGATTGGCTCGTGGTACAAGCCAATCACCAAGGGACGCAGCCACAAGCGTTACAAGAAGAGGGTGGTTCAGGCGCTAC
CACTTACAGCAATCAGCTAAAACTTATTCCCGCTCACATCACTTGGCGAGCAAGGCCTTGTGCTAAGCCGCAAGTGGATG
GTCCCATGATCGCCACCGTGGTTGGGCCACAAGGTGAAGAGATTTATTGCGATAACTTTGGTCGCGTGAAAGTGCATTTC
CCGTGGGATCGCTACTCAAGTAGCAACGAAAAAAGCTCTTGCTGGGTGCGAGTGGCACAAGAATGGGCTGGTAGCCAATA
CGGTAGTATGGCGATTCCGCGAGTTGGCCATGAAGTGATTGTTTCGTTCCTGAATGGCGATCCGGATCAACCCATCATCA
CAGGTCGTACGTATCATGCGACCAATACCGCGCCTTACGCCTTGCCTGACCACAAAACCAAAACCGTGCTGCGCACTGAG
ACTCACCAAGGGCAAGGCTACAACGAACTGAGTTTTGAGGATCAAGCGGGCAGCGAACAGATTTTGCTGCATGCACAAAA
AGATTGGGATGCGTTGATTGAGCATGATCACACCGAAGTGATTCGCCACGATCAACATCTCACTGTGGACAATGATCGCT
TTACCCGCATTCAGCGCAACCAACATTTAACGGTTGAAGGTGAAGTCCGTAGCAAAATCGCACTCGATAGCAGCCATGAA
GTCGGCGCGTCACTACAACACAAAGTCGGGCAGCGCATTGCTGTCGAGGCGGGTAAAGAGATTTCACTCAAAAGCGGCGC
AAAAATCGTGGTTGAAGCCGGAGCGGAGTTAACCCTAAAAGCTGGGGGCAGTTTTGTAAAAGTCGATGCTGGTGGCGTGC
ACTTAGTCGGTCCTGCCATTAACCTAAACGCGGGCGGCAGTGCAGGCAGCGGTAGCGCTTATGGCGGGCAATTAGCGGCA
GCACCGAGAATGTTAGCGCAAGCTAAACCAGTAGCAGAATTGGTTCAGCCGGATATTGCGGCCTCAATGCAATCAGGCGC
GGCGCGTGTTATTGATGTGGCATCACTCCCCACAATGATGCCGAGTTCAGCCAATAACACGGCAAATGATGAGCCTGTGG
CCGAAGAGAAAACACCGGAGCGAATTTTAAAATCCGATCTCCTCAAACCATCCGATGAGTTAGAGAAACTCGCCAAGCGA
CAAGCGAGTGCTTATCGTCAAGGTAATCACAGCGATGAGGTTAAGTTACTACAAGAAGCGCTCATAAAATTGGGGTTTGA
TCTCGGGAAAGCAGGAGCTGATGGTGACTTTGGGAGCAAAACTAAAACCGCGATTGAGCAGTTCCAGAAAAGCTATCAAC
CAAGCCACCAAACCCACCCGTCTTACAGCATTGGCGCTGTTGACGGTATTGTCGGCAAAGGTACACTACTGGCACTAGAC
GAAGCCTTGATGGATGGGTGGGTGTATGAGAATAATATTTATCAAATATGGCCTCTAGGTAAAACGTCAGAGAAATATGA
GTCGGCAGGAAGAGGCCCAGGGGTTATATCAACAGGAAATGGAGATTATGGTGGGGCTTCATATGGTTGCTATCAAATGT
CATCAAATCTTGGTGTGGTACAAAAATATATTCAGTCATCAAAATTCAAAGAATTCTTTAGTGGATTAAATCCCGCTACG
AAAGAGTTTAATGTTGTTTGGCAGGATATAGCTTCAAGATATCCTCAGGAATTCAGAGAAGAACAACACCAATTTATTAA
GAGAACTCATTATGATATACAAATAGGACATCTTAGAGGGAAAGGACTTTTGTTTGAACATAATCGAGCTGCTGTACATG
ATTTGATCTGGTCTACTTCAGTACAGTTTGGTGGGAGAACTAATTTGATTTTCAATGCATTGAATGGACAAAATATGGAA
AGTATGACTGATAAGGACATCATTATTCTGGTACAAGATTACAAGCTTGTTAATACAGAAAGGCTTTTTAAGTCTTCGCC
ATCATGGTGGAGTGATTTAAAAAAACGTGCGGTATCAGAGAAAAAAGCTTTACTTGAACTAGAAATTGACGGTTTGGAGG
TTGATATAAAATGA