Detailed information of immunity protein


Summary

Immunity protein ID IMU00156 experimental
Cognate effector EFF00008 experimental
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (248 a.a.); Nucleotide sequence (744 bp)
Description TsiV1
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VC1419 (TsiV1)
Coordinates (Strand) 1516533..1517276 (+)
NCBI ID 15641430
RefSeq NC_002505
Uniprot ID TSIV1_VIBCH
KEGG ID vch:VC_1419
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-11 MKLLNNLAIKK
Transmembrane helix 12-30 LISVVVLFIALFFLGYDYY
Outside 31-247 QTSQPNIWGDEPDESYITISGKKPIDAYLEVWTHFWVTGDECEAYSYDLFGQKAHQGGKISQKITHDFAKDGSNFEFRIPYQTYKNSQNCIVELRDFSIQAHNDFDTVGFAQLRFSPAGREYYNREVDLNSLITADNCNSDIFKSIRKEWAGAIGCHFYVDGKKKTKDEEFNAYTIYYDFSKFNNDTVIHYDILAGENYRSEPLSSAQKTAVVSDDN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9251 - -



  Protein sequence: 248 a.a.    .

>IMU00156 NC_002505:1516533-1517276 [Vibrio cholerae O1 biovar El Tor str. N16961]
MKLLNNLAIKKLISVVVLFIALFFLGYDYYQTSQPNIWGDEPDESYITISGKKPIDAYLEVWTHFWVTGDECEAYSYDLF
GQKAHQGGKISQKITHDFAKDGSNFEFRIPYQTYKNSQNCIVELRDFSIQAHNDFDTVGFAQLRFSPAGREYYNREVDLN
SLITADNCNSDIFKSIRKEWAGAIGCHFYVDGKKKTKDEEFNAYTIYYDFSKFNNDTVIHYDILAGENYRSEPLSSAQKT
AVVSDDN*

  Nucleotide sequence: 744 bp    .

>IMU00156 NC_002505:1516533-1517276 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGAAGTTATTGAATAATCTTGCAATAAAAAAGCTAATCTCAGTTGTTGTACTATTCATTGCATTATTTTTTCTTGGGTA
TGACTATTACCAGACTTCTCAACCTAATATTTGGGGTGATGAACCTGATGAGTCCTATATTACTATATCAGGCAAAAAGC
CTATAGATGCTTATTTAGAAGTGTGGACTCATTTTTGGGTGACAGGAGATGAGTGTGAAGCTTATTCCTACGATTTATTT
GGTCAAAAAGCCCATCAAGGAGGAAAAATAAGCCAGAAGATTACGCATGATTTTGCTAAAGATGGTTCAAATTTTGAATT
TAGAATTCCTTACCAAACGTATAAGAACTCACAAAATTGTATAGTGGAATTAAGAGACTTTTCCATACAAGCTCATAATG
ATTTTGATACCGTAGGTTTTGCTCAGTTGCGATTTTCTCCAGCAGGCAGAGAATATTACAATCGAGAGGTTGATCTAAAC
TCATTGATTACAGCAGATAATTGCAATAGTGATATATTTAAAAGTATAAGAAAAGAGTGGGCAGGAGCCATTGGTTGTCA
TTTTTATGTCGATGGAAAGAAAAAGACTAAAGATGAAGAATTCAACGCTTACACCATCTACTACGATTTTTCGAAATTCA
ATAATGACACCGTGATTCATTACGATATTTTAGCCGGTGAAAACTATCGGTCAGAGCCTTTGTCCTCAGCTCAAAAGACA
GCAGTGGTATCTGATGATAATTAA