Detailed information of effector


Summary

Effector ID EFF00008 experimental
Effector type Tle
Cognate immunity protein IMU00156 experimental
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (642 a.a.); Nucleotide sequence (1926 bp)
Description TseL (Tle2); lipase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VC1418 (TseL, Tle2)
Coordinates (Strand) 1514611..1516536 (+)
NCBI ID 15641429
RefSeq NC_002505
Uniprot ID TSEL_VIBCH
KEGG ID vch:VC1418
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Lipase_3 PF01764.27 5e-18 320..433

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-641 MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKIAAGEWRASVSQASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWDEAPKDEFLQKQHKGIDVNASAEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSYTFALLSKLAYATNDFNRDDGKTIDNQGAISTVISQLKRKERPTYSGDLQAKWLLEEIPYSKALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSKKPPVDNTKFKIIKAASGMAAVIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALLSLMEKDLGLHKIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRHVNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTYNSNNQVLLTPKQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALSDESLMVHYQRAISALEQEIATLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLIENRNKIRGELRQIVSDPQRMPATKFLISQQTLPDEIKVQIR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9852 - -



  Protein sequence: 642 a.a.    .

>EFF00008 NC_002505:1514611-1516536 [Vibrio cholerae O1 biovar El Tor str. N16961]
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKIAAGEWRASVSQASLLTEVEK
YASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWDEAPKDEFLQKQHKGIDVNASAEKAGFRLSHNQTYVFEIKA
LRSYMPVIIDTDEFNLVNSYTFALLSKLAYATNDFNRDDGKTIDNQGAISTVISQLKRKERPTYSGDLQAKWLLEEIPYS
KALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSKKPPVDNTKFKIIKAASGMAAVIADKIESATDSPGMKDLII
TDLDAAQIAPEEFGGTYVHRGFYQYTMALLSLMEKDLGLHKIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGM
PRVGTRSFVERYQNILHYRHVNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTY
NSNNQVLLTPKQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALSDESLMVHYQRAISALEQEIA
TLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLIENRNKIRGELRQIVSDPQRMPATKFLISQQTLPDEIKVQI
R*

  Nucleotide sequence: 1926 bp    .

>EFF00008 NC_002505:1514611-1516536 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGGATTCATTTAATTATTGCGTGCAGTGTAACCCTGAGGAAAACTGGTTAGAGCTAGAGTTTCGGAGTGAAAATGATGA
ACCGATAGATGGTTTGCTAGTTACGATTACGAACCAAAGTGCCCCCTCTAACACATACACGCAAACCACAAGTTCGGGTA
AGGTGTTGTTTGGCAAGATTGCGGCTGGGGAATGGCGTGCTTCTGTAAGCCAAGCTTCTCTGTTAACTGAAGTCGAAAAA
TATGCCAGCCGTAAAGAGGGACAAGAGTCGCCAGTGAAAAAACGAGCTGCGGCAGAACTTGACGCCGCAGATAAAGATAC
GAAGCAGTACCGCTTTACCACTATTGGTGATTTCTGGGATGAAGCACCAAAAGATGAGTTTTTACAAAAGCAGCATAAAG
GGATAGATGTCAATGCTTCTGCTGAGAAAGCAGGGTTTAGACTCAGTCATAACCAGACCTATGTTTTTGAAATCAAAGCA
CTACGTAGCTATATGCCAGTGATTATTGATACCGATGAATTTAACTTGGTGAATAGTTATACCTTTGCGTTGTTGTCGAA
ATTAGCTTATGCGACTAACGATTTTAATAGGGATGATGGTAAGACAATAGATAATCAGGGAGCAATTAGCACGGTTATTT
CTCAATTGAAGCGTAAAGAAAGACCGACTTATTCTGGAGATTTACAAGCAAAGTGGTTATTAGAGGAAATTCCATATAGC
AAAGCGTTAAGTGCCCAATATTATGCTGAGGATGATGTCGGTAGTGAAGGTTACATCATCTTTAACGATGAATTGGCGAT
TATAGGTGTGAGAGGTACAGAGCCTTATTTTCAGAGTAAGAAACCACCTGTTGATAACACTAAATTTAAAATTATAAAAG
CGGCTTCAGGTATGGCGGCTGTGATTGCGGATAAGATAGAAAGTGCTACCGATTCACCAGGAATGAAAGACCTTATTATA
ACAGACCTTGATGCTGCGCAAATCGCCCCCGAAGAGTTTGGTGGAACATATGTTCATCGGGGGTTTTACCAATATACGAT
GGCTTTGTTATCTTTGATGGAGAAAGATCTAGGGCTACATAAAATAAAAAAATTCTATTGTTGTGGCCATAGCTTAGGGG
GCGCTGGTGCATTACTTATAAGTGCATTGATTAAAGATAGCTATCATCCTCCAGTATTGCGTTTATATACATATGGAATG
CCACGAGTGGGAACTCGCAGTTTTGTAGAGCGCTATCAAAATATTTTGCATTACCGTCATGTTAATAATCACGATTTGGT
GCCACAGATACCAACAGTATGGATGAACACAGATGTATCTGAAGGATTCCATGTACTTGATGTATTTAAAAGCCGTGTTG
ATCTGATGAGAAAAATGCTCACTGATGATGATGATGACAATTATCAACACCATGGTCATTTGTCTCAGTTACTAACTTAT
AATTCAAATAACCAAGTCTTACTGACACCCAAACAAACTCAAGTCACTATGCTAGACCTAGCAAATTTAGCCACTAATGA
TTCTGTTGCTATGGTAGATGGTTTATCAGATGCCTCAATAGTAGAGCATGGAATGGAGCAGTATATACCCAATTTATTTG
AGCAGTTAACAGCACTAAGTGATGAAAGTTTAATGGTGCATTATCAACGAGCGATTTCAGCCTTAGAGCAGGAAATTGCT
ACGTTGCAACAAAGTTATCTTACAGTTAAACAAGCTTGGATTGAATCTATAGGAAATGGCACGCCGACTATGAATATCGG
ACGTTTGATGAGTGAAATGCATTCTATAAATAAATTAATAGAGAACCGTAATAAAATTAGAGGTGAGCTAAGGCAGATAG
TCTCTGATCCTCAGCGTATGCCTGCAACTAAATTTTTAATTTCACAGCAAACCTTACCAGATGAAATCAAGGTGCAAATA
AGATGA