Detailed information of effector


Summary

Effector ID EFF76651 experimental
Effector type Tse
Cognate immunity protein IMU38224 experimental
Related T6SS (Type) T6SS17503 experimental (Type i1)
Strain Aeromonas hydrophila strain NF1
Replicon chromosome
Sequence Protein sequence (1061 a.a.); Nucleotide sequence (3183 bp)
Description An average 9% of NF2-lux survived after incubation for 4 h with NF1, while survival of NF2-lux increased on average of 31% and 63% when mixed with NF1ΔtseC and NF1ΔvasK, respectively.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BE47_RS0112955 (tseC)
Coordinates (Strand) 59956..63138 (-)
NCBI ID WP_029301617.1
RefSeq NZ_JDWB01000029
Uniprot ID UPI0004939ECC
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-682 MSTPNQVAQCANTTDSKSPAGVCPLKNKKIAIIPVRYALDEPFSPPQKQPHPVPAGAGFVVPLKLKESGYALRQLRDGWLYVYDEKAKTFDEYEIKGATFISQSKGSKGHLLYPASHTLSLIYSPQRWTGRIKKEMGKNSSLRSVWMRQVKLGSFASTMKAPHCGLPDVLDKVADLGMSNKGFVLSSTPLAKPAEEDKQGIKLLAHKPAGSPAANKAGIPDPKSALVVALEDPLADLADLSMKVNQLLAKYEALLGKDDASIKVNSHKLMMAEVTRNLAKVRLEEKELPASVRGNVAKTQAFEEALDDYLGDRYLADMENMTAEPGMAMFSSPMEKRADAKLKILREQYGFNPSHKQVAQWKERAAFQDEVNWSGLNAFIKQYQVPLNELELALTRAHEDLFNGVTRLKADPLPFGLDNRTPKGQAYLQTLFAEAGQALSLSCRTEARKKALEKLLGEKNSDNLLALAPYGFDIALYKGLSEQTVANAWLSTSSGDMTALFGRTADLETLLGDERLKQKSWFQAVEAVIEAMKVVGKSMAKGAHAQIMAAILPHAWKNSLAGNLRLVLLESLLGEQPLQVNRDYRMLHSRFQQKVWIIVKEMSAISSPPPGRSTTVKAINGQLKTLQQQLDTLIASEMPLLVKLKGDLYQQQARQYVGDYLASVRSGVNQRITAMNERIPNL
Transmembrane helix 683-705 ATFGGLVALLNLWNLTVVIAGTA
Inside 706-819 QNAQSIGRERANMQLGSAFAWTGNAIAALYQGAAWEKLKPLTTGGGKRALTAISIKAAIKEGEHAVWVKAFSLRMLAFAGLGAAAAGLEAWDASLASKDPLISEMERTLLVSKA
Transmembrane helix 820-839 YVLWGQTGIFGVQVLLTLVS
Outside 840-853 RGVGGFAIGTVFAP
Transmembrane helix 854-876 WMVVGLFVLGIAYLVLTMLLNIF
Inside 877-1060 KRSDLEKWLLQSTWGKQPANWSAEDELARFESLVNKPGASLTVVRSPAQGWMDSGRPQWQLQLSLPTHLRGQTIGLKVIGQPIARAGQMVPVRSKEDLTRYQAAMQPRTLGTQRGRWDDMVYSLPLGIDTNSAIKLELGYLGGMIQRQFVFKGSSSSGGPVTLNSSNGDLGTMPALVVGKQGNK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9529 - -



  Protein sequence: 1061 a.a.    .

>EFF76651 NZ_JDWB01000029:c63138-59956 [Aeromonas hydrophila]
MSTPNQVAQCANTTDSKSPAGVCPLKNKKIAIIPVRYALDEPFSPPQKQPHPVPAGAGFVVPLKLKESGYALRQLRDGWL
YVYDEKAKTFDEYEIKGATFISQSKGSKGHLLYPASHTLSLIYSPQRWTGRIKKEMGKNSSLRSVWMRQVKLGSFASTMK
APHCGLPDVLDKVADLGMSNKGFVLSSTPLAKPAEEDKQGIKLLAHKPAGSPAANKAGIPDPKSALVVALEDPLADLADL
SMKVNQLLAKYEALLGKDDASIKVNSHKLMMAEVTRNLAKVRLEEKELPASVRGNVAKTQAFEEALDDYLGDRYLADMEN
MTAEPGMAMFSSPMEKRADAKLKILREQYGFNPSHKQVAQWKERAAFQDEVNWSGLNAFIKQYQVPLNELELALTRAHED
LFNGVTRLKADPLPFGLDNRTPKGQAYLQTLFAEAGQALSLSCRTEARKKALEKLLGEKNSDNLLALAPYGFDIALYKGL
SEQTVANAWLSTSSGDMTALFGRTADLETLLGDERLKQKSWFQAVEAVIEAMKVVGKSMAKGAHAQIMAAILPHAWKNSL
AGNLRLVLLESLLGEQPLQVNRDYRMLHSRFQQKVWIIVKEMSAISSPPPGRSTTVKAINGQLKTLQQQLDTLIASEMPL
LVKLKGDLYQQQARQYVGDYLASVRSGVNQRITAMNERIPNLATFGGLVALLNLWNLTVVIAGTAQNAQSIGRERANMQL
GSAFAWTGNAIAALYQGAAWEKLKPLTTGGGKRALTAISIKAAIKEGEHAVWVKAFSLRMLAFAGLGAAAAGLEAWDASL
ASKDPLISEMERTLLVSKAYVLWGQTGIFGVQVLLTLVSRGVGGFAIGTVFAPWMVVGLFVLGIAYLVLTMLLNIFKRSD
LEKWLLQSTWGKQPANWSAEDELARFESLVNKPGASLTVVRSPAQGWMDSGRPQWQLQLSLPTHLRGQTIGLKVIGQPIA
RAGQMVPVRSKEDLTRYQAAMQPRTLGTQRGRWDDMVYSLPLGIDTNSAIKLELGYLGGMIQRQFVFKGSSSSGGPVTLN
SSNGDLGTMPALVVGKQGNK*

  Nucleotide sequence: 3183 bp    .

>EFF76651 NZ_JDWB01000029:c63138-59956 [Aeromonas hydrophila]
ATGAGTACGCCCAATCAAGTCGCCCAGTGTGCAAACACGACCGACAGCAAGAGCCCGGCAGGAGTCTGTCCGCTCAAGAA
CAAGAAGATTGCCATCATTCCGGTGCGTTATGCCCTGGATGAGCCGTTTTCTCCGCCACAAAAGCAGCCTCATCCAGTCC
CAGCCGGAGCAGGTTTTGTGGTGCCTCTCAAGTTAAAAGAGAGTGGTTATGCTTTGCGTCAGCTGCGTGATGGCTGGCTC
TATGTGTATGACGAAAAGGCCAAGACATTCGATGAGTACGAGATAAAGGGGGCGACCTTCATCAGCCAGAGCAAGGGGAG
CAAGGGTCATCTGCTCTACCCGGCGAGTCACACCCTCTCTCTCATTTATTCTCCCCAGCGCTGGACTGGGCGCATCAAGA
AAGAAATGGGAAAAAATAGCAGCTTGCGTAGCGTCTGGATGCGACAAGTCAAACTGGGCAGTTTTGCCAGCACCATGAAG
GCCCCTCATTGCGGTCTGCCTGATGTGCTCGACAAGGTTGCGGACCTGGGGATGTCCAACAAGGGATTTGTGCTCTCTTC
TACCCCCCTTGCCAAGCCTGCCGAAGAGGACAAGCAGGGGATCAAGTTGCTGGCACACAAACCTGCGGGTTCACCGGCTG
CCAACAAGGCGGGCATACCGGATCCTAAAAGTGCCCTGGTAGTCGCCCTGGAGGATCCACTGGCCGACCTTGCCGATCTT
TCCATGAAGGTGAATCAACTGCTCGCCAAGTACGAAGCACTGTTGGGGAAAGATGATGCCTCCATCAAGGTCAACAGCCA
CAAGCTGATGATGGCAGAAGTAACGCGCAATCTTGCCAAAGTGCGGCTTGAAGAGAAGGAGTTACCCGCCTCCGTCAGGG
GCAATGTCGCCAAGACTCAGGCCTTTGAAGAGGCGCTGGATGATTATCTTGGGGATCGCTACCTCGCCGACATGGAGAAT
ATGACGGCAGAGCCAGGAATGGCGATGTTCAGTTCCCCTATGGAGAAACGAGCCGATGCCAAGCTGAAGATCCTGCGGGA
ACAGTATGGTTTCAACCCATCCCACAAGCAGGTCGCCCAATGGAAGGAGCGCGCCGCCTTCCAGGATGAGGTCAATTGGA
GCGGGCTCAATGCCTTTATCAAGCAGTATCAGGTACCACTCAATGAGCTGGAGCTGGCGTTGACACGGGCTCATGAAGAC
CTGTTCAACGGCGTGACCCGCCTCAAGGCCGATCCGTTGCCCTTTGGTCTGGACAACAGAACACCCAAGGGACAAGCCTA
TCTGCAGACCCTGTTTGCCGAGGCAGGGCAGGCACTCTCTCTCAGCTGTCGCACGGAGGCCAGAAAGAAAGCGCTGGAAA
AACTGCTTGGCGAAAAGAACAGCGACAACTTGCTGGCGCTGGCCCCTTATGGCTTTGATATTGCGCTGTACAAGGGATTG
AGCGAGCAGACGGTCGCCAATGCTTGGCTCAGTACCTCATCTGGCGATATGACAGCCCTCTTTGGCAGAACGGCCGATCT
GGAAACGCTATTGGGGGACGAGAGGCTCAAGCAGAAATCCTGGTTCCAGGCAGTGGAAGCCGTGATTGAAGCCATGAAAG
TGGTTGGAAAATCCATGGCCAAGGGGGCACACGCCCAGATCATGGCGGCCATCTTGCCCCACGCCTGGAAGAACAGCCTG
GCAGGCAACCTCAGGCTGGTATTGCTGGAGTCCCTGCTCGGCGAACAGCCGTTGCAGGTGAACCGAGACTATCGGATGCT
CCACAGCCGCTTCCAGCAGAAGGTCTGGATCATTGTGAAGGAGATGTCGGCCATCAGCTCCCCCCCTCCCGGGCGCAGCA
CCACGGTGAAGGCCATCAACGGTCAGCTAAAAACCTTGCAGCAACAGCTTGATACCCTGATTGCCAGCGAAATGCCCCTG
CTGGTGAAACTGAAAGGTGATCTCTACCAGCAACAAGCCAGACAATATGTTGGTGACTATCTGGCGAGTGTACGTAGCGG
CGTGAATCAACGCATCACGGCCATGAACGAGAGAATTCCCAATCTGGCGACCTTTGGCGGGCTGGTTGCCCTGCTCAACC
TCTGGAATCTGACAGTGGTCATCGCAGGGACGGCGCAAAACGCCCAGTCCATCGGTCGGGAACGGGCAAATATGCAGTTG
GGCTCGGCCTTCGCCTGGACGGGCAATGCCATCGCCGCGCTCTATCAGGGGGCTGCATGGGAGAAGTTAAAGCCGCTCAC
TACTGGTGGGGGTAAACGAGCCCTGACAGCAATCTCGATAAAAGCAGCAATAAAAGAAGGTGAACATGCGGTTTGGGTTA
AAGCCTTCTCTCTACGGATGCTGGCGTTTGCTGGGTTAGGTGCTGCGGCAGCAGGACTGGAAGCTTGGGATGCCTCATTG
GCTAGCAAAGACCCTTTAATTAGCGAGATGGAAAGAACTTTGCTGGTTTCGAAGGCGTATGTTCTTTGGGGACAAACGGG
CATTTTTGGGGTCCAAGTATTGCTTACGCTGGTGAGTCGTGGTGTTGGGGGATTCGCAATTGGTACCGTTTTTGCCCCCT
GGATGGTTGTCGGGCTCTTTGTGCTGGGTATCGCCTATCTGGTACTGACTATGCTGCTGAATATATTTAAACGCTCAGAC
CTGGAAAAGTGGTTGCTGCAATCAACCTGGGGCAAGCAGCCTGCCAACTGGTCTGCCGAGGATGAACTGGCTCGCTTCGA
GTCGCTGGTCAATAAACCGGGTGCCAGCCTGACGGTAGTGCGCTCCCCGGCCCAGGGCTGGATGGACAGCGGCCGCCCCC
AGTGGCAGTTGCAACTCTCGCTGCCGACTCACTTGCGAGGGCAGACTATAGGTTTAAAGGTCATCGGCCAGCCAATTGCT
CGCGCCGGTCAAATGGTGCCGGTGCGTTCCAAAGAGGATCTGACGCGCTATCAGGCTGCCATGCAGCCCAGAACGCTGGG
GACACAGCGCGGACGTTGGGATGACATGGTCTATTCCTTGCCGCTGGGGATTGATACCAATTCGGCTATCAAACTGGAGT
TAGGGTATCTCGGGGGTATGATTCAGCGGCAATTTGTCTTCAAGGGCAGCAGTAGCAGTGGTGGCCCAGTCACATTGAAT
AGCAGCAACGGCGATCTGGGTACCATGCCCGCGTTGGTGGTCGGCAAGCAAGGGAATAAATAA