Detailed information of effector


Summary

Effector ID EFF76650 experimental
Effector type Tse
Cognate immunity protein IMU00361 experimental
Related T6SS (Type) T6SS00788 experimental (Type i1)
Strain Aeromonas dhakensis strain SSU
Replicon chromosome
Sequence Protein sequence (1062 a.a.); Nucleotide sequence (3186 bp)
Description TseC is predicted to carry a colicin domain. Periplasmic expression of the colicin domain reduced the survival of E. coli to 1% after induction, indicating that A. hydrophila TseC is potently antibacterial.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) HMPREF1171_RS12055 (tseC)
Coordinates (Strand) 2753469..2756654 (-)
NCBI ID WP_005303625.1
RefSeq NZ_JH815591
Uniprot ID K1JD30_9GAMM
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-682 MSTPNQAAQCANTTDSKSPAGVCPLKNKKIAIIPVRYALDEPFSPPQKQPHPVPAGAGFVVPLKLKESGYALRQLRDGWLYVYDEKTKTFDEYEIKGSTFINQSKGSKGHLLYPASHTLSLAYSPQRWTGRIKHEMEKSGGLRTTWMRQVKLGSFASTMKAPHCGLPDVLDKVADLGMSNKGFVLSSTPLAKPAEEDKQGIKLLAHKPASLPTAYKAGIPDPKSAMVVALEDPLADLADLSMKVNQLLAKREALLGKGDATIKVNSHKLMMAEITRNLARVRLDEKVLPASVRGNVARTQAFEEALDDYLGDRYLADMESMTAEPGMVRINSPMEKRADEKLKILREQYGFNPSQKQVAQWKERAAFQDEVNWSGLNAFIKQYQVPLNELELALTRAHEDLFNGVARLKADPLPFGLDNRTPKGQAYLQTLFAEAGPVLSLSCRTEERKKALEKLLGEKSRDNLLALAPYGFDAALHKGLSELTVDNAWLSTSSGDMTALFGRTADLETLLGDERFKQKSWFQTIEAVIEAMKVAGKSMAKGAHAQIMAAILPHAWKNSLAGNLRLVLLESLLGDQPLQVNRDYRMLHNRFQQKVWIIVKEMSAISSPPPGRSTTVKAINSQLKTLQQQLDNLIASEMPLLVKLKGDLYQQQARQYVGDYLASVRSGVNQRITAMNERIPNL
Transmembrane helix 683-705 ATFGGLVALLNLWNLTVVIAGTA
Inside 706-815 QNAQSIGRERANMQLGSAFAWTGNAIAALYQGAVWEKLKPLVINGKTLTSLPISDVLGSESGALIKSFSMRMLAFAGLGMVAAGAEMWDTFQASQDPLISDMEKTLLQMK
Transmembrane helix 816-835 AVVLLGQGGIFFTQLVFLGI
Outside 836-849 NGLGGLSIAAIFAP
Transmembrane helix 850-872 WMTVGLFVLGAAYLVLTVLLNIF
Inside 873-1061 KRSDLEKWLLQSTWGKQPANWSAEDELARFELLVNKPGASLTVVRSPAKGWMDTGRPQWQLQLSLPAHLRGQTIGLNVTSQPLARAGQMVPVRSKEELARYQATMQPRTLETQRGRWDDLVYTLPLGVDTNSAIKLELGYMGGMVQRQFVFKGNGNSGGPITLNSSSGELSSMPALVVGKQGINNEQHE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9330 - -



  Protein sequence: 1062 a.a.    .

>EFF76650 NZ_JH815591:c2756654-2753469 [Aeromonas dhakensis]
MSTPNQAAQCANTTDSKSPAGVCPLKNKKIAIIPVRYALDEPFSPPQKQPHPVPAGAGFVVPLKLKESGYALRQLRDGWL
YVYDEKTKTFDEYEIKGSTFINQSKGSKGHLLYPASHTLSLAYSPQRWTGRIKHEMEKSGGLRTTWMRQVKLGSFASTMK
APHCGLPDVLDKVADLGMSNKGFVLSSTPLAKPAEEDKQGIKLLAHKPASLPTAYKAGIPDPKSAMVVALEDPLADLADL
SMKVNQLLAKREALLGKGDATIKVNSHKLMMAEITRNLARVRLDEKVLPASVRGNVARTQAFEEALDDYLGDRYLADMES
MTAEPGMVRINSPMEKRADEKLKILREQYGFNPSQKQVAQWKERAAFQDEVNWSGLNAFIKQYQVPLNELELALTRAHED
LFNGVARLKADPLPFGLDNRTPKGQAYLQTLFAEAGPVLSLSCRTEERKKALEKLLGEKSRDNLLALAPYGFDAALHKGL
SELTVDNAWLSTSSGDMTALFGRTADLETLLGDERFKQKSWFQTIEAVIEAMKVAGKSMAKGAHAQIMAAILPHAWKNSL
AGNLRLVLLESLLGDQPLQVNRDYRMLHNRFQQKVWIIVKEMSAISSPPPGRSTTVKAINSQLKTLQQQLDNLIASEMPL
LVKLKGDLYQQQARQYVGDYLASVRSGVNQRITAMNERIPNLATFGGLVALLNLWNLTVVIAGTAQNAQSIGRERANMQL
GSAFAWTGNAIAALYQGAVWEKLKPLVINGKTLTSLPISDVLGSESGALIKSFSMRMLAFAGLGMVAAGAEMWDTFQASQ
DPLISDMEKTLLQMKAVVLLGQGGIFFTQLVFLGINGLGGLSIAAIFAPWMTVGLFVLGAAYLVLTVLLNIFKRSDLEKW
LLQSTWGKQPANWSAEDELARFELLVNKPGASLTVVRSPAKGWMDTGRPQWQLQLSLPAHLRGQTIGLNVTSQPLARAGQ
MVPVRSKEELARYQATMQPRTLETQRGRWDDLVYTLPLGVDTNSAIKLELGYMGGMVQRQFVFKGNGNSGGPITLNSSSG
ELSSMPALVVGKQGINNEQHE*

  Nucleotide sequence: 3186 bp    .

>EFF76650 NZ_JH815591:c2756654-2753469 [Aeromonas dhakensis]
ATGAGTACGCCCAATCAAGCCGCCCAGTGTGCAAACACGACCGACAGCAAGAGCCCGGCAGGAGTCTGTCCGCTCAAGAA
CAAGAAGATTGCCATCATCCCGGTGCGTTATGCCCTGGATGAGCCGTTCTCCCCGCCACAAAAGCAGCCTCACCCAGTCC
CCGCCGGAGCAGGCTTTGTGGTGCCTCTCAAGTTGAAAGAGAGCGGTTATGCATTGCGCCAACTGCGTGATGGCTGGCTC
TATGTGTATGACGAAAAGACCAAGACATTTGATGAGTACGAGATAAAAGGATCGACCTTCATCAACCAGAGCAAGGGAAG
CAAGGGGCATCTGCTCTACCCGGCGAGCCATACCCTCTCCCTCGCTTATTCTCCCCAGCGCTGGACGGGGCGCATCAAGC
ATGAGATGGAAAAGAGCGGCGGTTTGCGCACCACCTGGATGCGGCAGGTGAAACTGGGCAGTTTTGCCAGCACCATGAAG
GCCCCTCATTGCGGTCTGCCAGATGTGCTTGACAAGGTTGCGGACCTGGGGATGTCCAACAAGGGATTTGTGCTCTCTTC
TACCCCTCTTGCCAAGCCTGCCGAAGAGGACAAGCAGGGGATCAAGTTGCTGGCTCACAAACCTGCGAGTTTACCGACTG
CCTACAAGGCGGGCATACCGGATCCCAAGAGCGCCATGGTGGTCGCTCTGGAGGACCCGCTGGCCGACCTTGCCGACCTT
TCCATGAAGGTCAATCAACTGCTTGCCAAGCGCGAAGCACTGCTGGGGAAAGGTGATGCCACCATCAAGGTCAACAGCCA
CAAGCTGATGATGGCGGAGATCACGCGCAACCTGGCCAGGGTGCGGCTCGACGAGAAGGTGTTACCCGCCTCCGTCAGGG
GCAATGTCGCCAGGACCCAGGCCTTTGAAGAGGCGCTGGATGATTATCTTGGGGATCGCTACCTCGCCGACATGGAGAGC
ATGACGGCAGAGCCCGGGATGGTGCGGATCAACTCCCCCATGGAGAAACGGGCTGATGAGAAGCTGAAAATCTTGCGAGA
ACAGTATGGTTTCAACCCATCCCAAAAACAGGTCGCCCAATGGAAAGAGCGCGCAGCCTTCCAGGATGAGGTCAACTGGA
GCGGGCTCAATGCGTTTATCAAGCAGTACCAGGTGCCACTCAATGAGCTGGAGCTGGCCCTGACGCGGGCTCATGAAGAT
CTGTTCAACGGTGTGGCCCGCCTCAAGGCCGATCCGCTGCCCTTTGGTCTGGACAACAGAACACCCAAGGGACAAGCCTA
TCTGCAGACCCTGTTTGCCGAGGCCGGGCCGGTTCTCTCTCTTAGCTGCCGCACGGAGGAGAGGAAGAAAGCGCTGGAGA
AACTGCTGGGCGAAAAGAGCCGCGACAACTTGCTGGCGCTAGCCCCTTATGGCTTTGATGCCGCGTTGCACAAGGGATTG
AGCGAGCTGACGGTAGACAATGCCTGGCTCAGCACCTCCTCTGGCGATATGACAGCACTCTTTGGCAGAACGGCTGATCT
GGAGACGCTACTGGGGGACGAGAGATTCAAGCAAAAATCCTGGTTCCAGACGATCGAAGCCGTCATTGAAGCCATGAAAG
TGGCTGGAAAATCCATGGCCAAGGGGGCTCACGCCCAAATCATGGCGGCCATCTTGCCCCATGCCTGGAAGAACAGCCTG
GCAGGCAACCTCAGGCTCGTATTGCTGGAATCCCTGCTCGGCGACCAGCCGCTGCAGGTGAACCGAGACTATCGGATGCT
CCACAACCGCTTCCAGCAGAAGGTCTGGATCATTGTCAAAGAGATGTCGGCCATCAGCTCCCCCCCTCCCGGGCGCAGTA
CCACGGTGAAGGCCATCAACAGTCAGCTAAAAACCTTGCAACAACAGCTTGATAACCTGATTGCCAGCGAAATGCCCCTG
CTGGTGAAACTGAAAGGCGATCTCTACCAGCAACAAGCCAGACAATATGTTGGTGACTATCTGGCGAGCGTACGTAGCGG
CGTGAATCAACGCATCACGGCCATGAACGAGAGAATTCCCAATCTGGCGACCTTTGGCGGGTTGGTTGCCCTGCTCAACC
TCTGGAATCTGACAGTGGTCATCGCAGGGACGGCGCAAAACGCTCAGTCCATCGGCCGGGAACGGGCAAATATGCAGCTG
GGCTCAGCCTTCGCCTGGACGGGCAATGCCATCGCCGCGCTCTATCAGGGGGCTGTTTGGGAGAAGCTAAAACCTCTAGT
AATTAACGGTAAAACACTGACATCATTGCCTATTAGTGATGTGCTGGGAAGTGAGAGTGGAGCTTTGATTAAGTCATTCT
CTATGCGGATGTTAGCTTTTGCTGGATTGGGAATGGTGGCTGCAGGGGCAGAGATGTGGGATACCTTCCAGGCTAGTCAA
GATCCCCTGATAAGTGATATGGAAAAGACACTCTTGCAGATGAAAGCGGTCGTATTGTTAGGCCAGGGGGGGATCTTTTT
TACTCAGCTTGTGTTCTTAGGTATCAATGGGTTGGGTGGCTTGTCCATAGCAGCTATTTTTGCACCCTGGATGACGGTTG
GGTTATTTGTATTGGGCGCGGCCTATCTGGTACTGACAGTGCTGCTGAATATCTTTAAACGCTCGGATCTGGAGAAATGG
TTGCTGCAATCCACCTGGGGAAAACAACCTGCCAACTGGTCCGCAGAAGACGAACTGGCTCGCTTCGAGTTGTTGGTCAA
TAAACCGGGCGCCAGCCTGACGGTGGTGCGCTCGCCGGCCAAAGGCTGGATGGATACCGGTCGCCCCCAGTGGCAGTTGC
AACTCTCGCTCCCCGCCCATTTGCGAGGACAAACAATAGGGTTAAATGTCACTTCTCAACCACTTGCCAGAGCTGGCCAG
ATGGTGCCGGTACGATCCAAAGAGGAGCTGGCGCGCTATCAGGCAACCATGCAGCCCAGGACGCTGGAGACACAACGCGG
ACGTTGGGATGATCTGGTCTATACCTTGCCTTTGGGGGTCGATACCAATAGTGCCATCAAGTTGGAACTGGGATATATGG
GCGGTATGGTACAGCGGCAATTTGTCTTCAAGGGCAACGGCAACAGTGGTGGACCTATCACTTTGAACTCCAGCAGCGGT
GAATTAAGTTCTATGCCCGCCCTAGTCGTTGGTAAGCAAGGAATAAATAATGAACAACACGAATGA