Detailed information of effector


Summary

Effector ID EFF76643 experimental
Effector type Tae
Cognate immunity protein IMU38216 experimental
Related T6SS (Type) T6SS01213 experimental (Type i3)
Strain Pseudomonas aeruginosa PAK
Replicon chromosome
Sequence Protein sequence (155 a.a.); Nucleotide sequence (465 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Y880_RS06360 (tse1)
Coordinates (Strand) 1318816..1319280 (-)
NCBI ID WP_016253554.1
RefSeq NZ_CP020659
Uniprot ID UPI000340E4A0
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-154 MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVNGLEQSWTKLASGAEAAQKAAQGFLVIAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRLNYYVYSLASCSLPRAS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9773 - -



  Protein sequence: 155 a.a.    .

>EFF76643 NZ_CP020659:c1319280-1318816 [Pseudomonas aeruginosa PAK]
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVNGLEQSWTKLASGAEAAQKAAQGFLV
IAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRLNYYVYSLASCSLPRAS*

  Nucleotide sequence: 465 bp    .

>EFF76643 NZ_CP020659:c1319280-1318816 [Pseudomonas aeruginosa PAK]
ATGGACAGTCTCGATCAATGCATCGTCAACGCCTGCAAGAACAGCTGGGACAAGAGCTACCTGGCCGGCACCCCGAACAA
GGACAACTGTTCCGGCTTCGTCCAGTCGGTGGCCGCCGAGCTGGGCGTACCGATGCCCCGCGGCAACGCCAACGCCATGG
TCAACGGCCTGGAGCAGAGCTGGACCAAGCTCGCCTCCGGCGCCGAGGCCGCGCAGAAGGCGGCCCAGGGCTTCCTGGTG
ATCGCCGGCCTGAAGGGCCGCACCTACGGGCACGTCGCGGTGGTCATCAGCGGTCCGCTGTATCGGCAGAAGTACCCGAT
GTGCTGGTGCGGCAGCATCGCCGGCGCGGTCGGCCAGAGCCAGGGCCTGAAGTCGGTCGGCCAGGTGTGGAATCGCACCG
ACCGCGACCGCCTCAACTACTACGTCTACTCCCTGGCCAGTTGCAGCCTGCCCAGGGCCAGTTGA