Detailed information of effector


Summary

Effector ID EFF76640 experimental
Effector type Tme
Cognate immunity protein IMU38213 experimental
Related T6SS (Type) T6SS00126 experimental (Type i4b)
Strain Burkholderia cenocepacia AU 1054
Replicon chromosome
Sequence Protein sequence (859 a.a.); Nucleotide sequence (2577 bp)
Description The E-I deletion mutant was outcompeted by its parental strain in a T6SS-dependent manner. Ectopic expression of the cognate immunity gene in each mutant rescued it from T6SS-mediated killing by the parental strain, providing evidence that Tle1-Tli1, Tne1-Tni1, Tne2-Tni2, and Tpe1-Tpi1 are true antibacterial E-I pairs associated with the BcAU1054 T6SS.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BCEN_RS22905 (tpe1)
Coordinates (Strand) 1873432..1876008 (-)
NCBI ID WP_011548259.1
RefSeq NC_008061
Uniprot ID A0A0H2XWX1_BURCA, A0A3R9C645_9BURK
KEGG ID bcn:Bcen_4615
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-740 MALDTNFASISQLTQSAMQTSSRAPNSCNMCKKKGLPILPVRYGVVANSKAHSSAGAMSLMGGKFGDGVVGIALKKAKYTLRTLRYGYVYIFYPKTQRWQIYAVTAEGYLYDYPVGIKLDRSFEKPFSCHQPGHAQLAQCITVEDAEHAGTVYLAFSDELWTQKVRDTYAKNFMGCRDKRMQKFDATAWYNGSMNQPHADSLDHLEGLLSEYKGGRPDALVTGCFPYHDRAGQQPALKKAMDSILPDKGLFFALWDPVGITQELNFEQRVAFGAALAPYEHGIWAASAIDALQKAVAVSAKEDVERAAGMLEANTYEGMGLGALFDGGKALEKRLKSIEAQKESELATAGPEAWKPYTTHYRQQAIVDFRQQMANAMKSEQASTLIPLSQDHQAWLSSAALLNVFESDYEPGSWRCGLNYTNTFTRCIEGSADRKNAVDVLVKWAKGSVSDTRNPLLRAFVLNSPVLAEKVKEASGYPYMELREFVAKLIESYSKIEGVEESKDKGIKVAVAKALAWLLHETGGPVAEAISASVDTAATKVLYATLCMRTKQLFEFKVVYGSVNQWVNYIARQMQEVMPGRQKISVQDLKKQLQDKANAGGGADPQIKAKQFVPVESPATEAAALAGVKAKPGFEKLASATLTPDVVETIYMPKFRLMTKGEPGFAGIGAIFSAINLRFAREELKKANRFNQSEAGIKFDNAIGGLVASVAQYGSAAIDTVGKAGAQLGTGWLRLERFLN
Transmembrane helix 741-763 VAGRYGGAVVGLVSAAIDIYHAV
Inside 764-771 QDFKEGNV
Transmembrane helix 772-794 TMFILDAASAVVGLALAYSVIFL
Outside 795-797 SAS
Transmembrane helix 798-820 AAAVVALPLLLIAALIGILINYF
Inside 821-858 KGKEVDEWLERCFFGLKEAKERFPTLAEDQKAFTAMLS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8591 - -



  Protein sequence: 859 a.a.    .

>EFF76640 NC_008061:c1876008-1873432 [Burkholderia cenocepacia AU 1054]
MALDTNFASISQLTQSAMQTSSRAPNSCNMCKKKGLPILPVRYGVVANSKAHSSAGAMSLMGGKFGDGVVGIALKKAKYT
LRTLRYGYVYIFYPKTQRWQIYAVTAEGYLYDYPVGIKLDRSFEKPFSCHQPGHAQLAQCITVEDAEHAGTVYLAFSDEL
WTQKVRDTYAKNFMGCRDKRMQKFDATAWYNGSMNQPHADSLDHLEGLLSEYKGGRPDALVTGCFPYHDRAGQQPALKKA
MDSILPDKGLFFALWDPVGITQELNFEQRVAFGAALAPYEHGIWAASAIDALQKAVAVSAKEDVERAAGMLEANTYEGMG
LGALFDGGKALEKRLKSIEAQKESELATAGPEAWKPYTTHYRQQAIVDFRQQMANAMKSEQASTLIPLSQDHQAWLSSAA
LLNVFESDYEPGSWRCGLNYTNTFTRCIEGSADRKNAVDVLVKWAKGSVSDTRNPLLRAFVLNSPVLAEKVKEASGYPYM
ELREFVAKLIESYSKIEGVEESKDKGIKVAVAKALAWLLHETGGPVAEAISASVDTAATKVLYATLCMRTKQLFEFKVVY
GSVNQWVNYIARQMQEVMPGRQKISVQDLKKQLQDKANAGGGADPQIKAKQFVPVESPATEAAALAGVKAKPGFEKLASA
TLTPDVVETIYMPKFRLMTKGEPGFAGIGAIFSAINLRFAREELKKANRFNQSEAGIKFDNAIGGLVASVAQYGSAAIDT
VGKAGAQLGTGWLRLERFLNVAGRYGGAVVGLVSAAIDIYHAVQDFKEGNVTMFILDAASAVVGLALAYSVIFLSASAAA
VVALPLLLIAALIGILINYFKGKEVDEWLERCFFGLKEAKERFPTLAEDQKAFTAMLS*

  Nucleotide sequence: 2577 bp    .

>EFF76640 NC_008061:c1876008-1873432 [Burkholderia cenocepacia AU 1054]
ATGGCACTCGACACGAATTTTGCGAGTATTTCGCAGCTCACGCAGTCCGCGATGCAGACCAGCTCGCGTGCGCCGAATTC
ATGCAACATGTGCAAGAAGAAGGGATTGCCGATTCTGCCTGTCCGCTACGGGGTCGTGGCCAACTCCAAGGCTCACAGCT
CTGCTGGCGCGATGTCGCTCATGGGCGGAAAGTTTGGCGACGGCGTCGTCGGCATCGCGCTCAAAAAGGCAAAGTACACG
CTGCGCACCCTGCGCTACGGCTACGTGTATATCTTCTATCCAAAGACACAGCGATGGCAGATATACGCGGTTACGGCGGA
AGGATACTTGTACGACTATCCGGTCGGCATCAAGCTCGACCGTAGTTTCGAGAAACCGTTCAGCTGCCACCAACCTGGGC
ATGCGCAACTGGCTCAATGCATCACCGTTGAAGATGCAGAACATGCCGGAACCGTGTATCTGGCGTTCAGCGATGAGCTT
TGGACACAGAAAGTCCGCGACACCTACGCGAAGAACTTCATGGGTTGTCGTGACAAGCGGATGCAGAAGTTCGATGCAAC
CGCCTGGTATAACGGCAGCATGAACCAGCCGCACGCGGATAGCCTGGACCATCTCGAGGGGCTACTGAGCGAATACAAGG
GCGGTCGTCCCGATGCGCTCGTTACCGGTTGCTTTCCGTACCATGACCGTGCCGGGCAGCAGCCGGCCCTCAAAAAGGCG
ATGGATTCCATACTGCCGGACAAGGGGCTGTTCTTCGCGTTGTGGGACCCGGTTGGCATCACGCAGGAACTCAATTTTGA
GCAGCGCGTTGCTTTCGGCGCAGCGCTTGCGCCGTATGAACACGGAATATGGGCCGCCAGCGCAATCGACGCGCTGCAAA
AGGCGGTCGCGGTTTCGGCGAAAGAGGACGTGGAACGTGCCGCCGGCATGCTGGAAGCCAATACTTATGAGGGCATGGGC
CTCGGGGCTCTGTTCGATGGTGGCAAGGCGCTCGAGAAGCGGCTCAAAAGCATTGAGGCGCAGAAGGAGTCTGAACTTGC
AACAGCCGGACCGGAAGCATGGAAGCCCTACACGACCCACTATCGGCAGCAGGCTATCGTCGACTTTCGGCAACAGATGG
CGAACGCGATGAAGTCGGAGCAGGCGAGCACGCTTATACCGCTGTCGCAAGACCATCAGGCGTGGCTGTCCAGTGCCGCA
TTGCTGAACGTTTTCGAGTCGGATTACGAGCCGGGAAGCTGGAGATGTGGGCTGAACTATACCAACACATTTACACGATG
CATCGAAGGCTCGGCTGACCGCAAGAATGCCGTCGATGTGCTCGTCAAATGGGCTAAAGGCAGCGTATCTGATACTCGCA
ATCCATTGTTGCGGGCGTTCGTCCTAAACAGCCCGGTGCTGGCTGAGAAGGTCAAGGAGGCGTCCGGCTATCCGTACATG
GAACTGAGGGAGTTCGTCGCGAAGCTCATAGAGTCGTACAGCAAGATAGAGGGCGTGGAAGAGTCGAAGGATAAGGGCAT
CAAAGTTGCTGTTGCGAAGGCGTTAGCATGGCTTCTTCATGAGACAGGTGGGCCCGTGGCCGAAGCTATCAGCGCGAGTG
TAGATACGGCTGCAACCAAAGTGCTGTATGCGACTCTGTGCATGCGAACGAAACAGCTGTTCGAGTTTAAGGTCGTATAC
GGTTCGGTAAACCAATGGGTGAACTACATCGCCCGTCAGATGCAGGAAGTGATGCCGGGCCGGCAGAAAATCAGTGTCCA
GGACCTGAAAAAGCAGCTTCAGGACAAAGCCAATGCAGGCGGAGGCGCCGACCCGCAAATTAAGGCGAAGCAGTTCGTGC
CAGTCGAAAGCCCGGCGACAGAGGCAGCTGCCCTGGCTGGCGTCAAAGCCAAACCCGGCTTCGAGAAATTGGCCAGTGCG
ACGTTGACACCCGACGTGGTCGAGACGATTTACATGCCGAAATTTAGGCTCATGACGAAGGGGGAGCCTGGGTTTGCGGG
CATCGGGGCGATATTCAGTGCTATCAATCTTCGCTTTGCTCGGGAAGAATTGAAGAAGGCGAATCGGTTCAATCAATCGG
AGGCCGGCATCAAGTTCGACAACGCCATTGGTGGACTCGTGGCGAGTGTTGCGCAATATGGTTCGGCTGCAATTGACACC
GTCGGAAAGGCTGGGGCTCAGTTGGGTACAGGCTGGCTTCGACTAGAACGTTTCCTCAACGTCGCGGGGAGGTACGGCGG
CGCGGTGGTTGGGCTCGTGTCTGCTGCGATTGACATCTATCATGCCGTGCAGGATTTCAAGGAAGGTAATGTGACGATGT
TTATCCTGGATGCCGCATCAGCGGTTGTCGGTCTTGCTCTCGCTTACTCTGTCATATTCCTTTCGGCATCCGCTGCAGCG
GTCGTGGCCCTGCCGCTTCTGCTTATCGCTGCCCTTATTGGTATCCTCATCAACTACTTCAAGGGTAAGGAAGTGGATGA
GTGGCTTGAGCGATGTTTTTTTGGGCTGAAAGAGGCCAAAGAGCGGTTCCCCACTCTGGCCGAAGACCAAAAGGCATTTA
CGGCAATGCTTTCGTGA