Detailed information of effector


Summary

Effector ID EFF76639 experimental
Effector type Tde
Cognate immunity protein IMU38212 experimental
Related T6SS (Type) T6SS00126 experimental (Type i4b)
Strain Burkholderia cenocepacia AU 1054
Replicon chromosome
Sequence Protein sequence (1495 a.a.); Nucleotide sequence (4485 bp)
Description The E-I deletion mutant was outcompeted by its parental strain in a T6SS-dependent manner. Ectopic expression of the cognate immunity gene in each mutant rescued it from T6SS-mediated killing by the parental strain, providing evidence that Tle1-Tli1, Tne1-Tni1, Tne2-Tni2, and Tpe1-Tpi1 are true antibacterial E-I pairs associated with the BcAU1054 T6SS.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BCEN_RS16675 (tne2)
Coordinates (Strand) 433352..437836 (+)
NCBI ID WP_011547150.1
RefSeq NC_008061
Uniprot ID A0A0H2XUQ4_BURCA, A0A3R9CM58_9BURK
KEGG ID bcn:Bcen_3344
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tox-SHH PF15652.8 1.4e-29 1383..1484
DUF6531 PF20148.1 1.8e-17 346..419
PAAR_motif PF05488.15 2.9e-15 203..267
RHS_repeat PF05593.16 1.4e-08 890..920
RHS_repeat PF05593.16 4.3e-08 847..884
RHS PF03527.16 1.3e-07 1257..1287
RHS_repeat PF05593.16 8.5e-07 635..669
RHS_repeat PF05593.16 8.4e-05 675..711

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-49 MSDTPNYNEPSGSAQERLDQIAGLEDGEAAKAAEQPFYEHLNYGMLGAD
Transmembrane helix 50-72 AGLTAVEGTAAGLGAAGTALAGG
Inside 73-78 ATGGAA
Transmembrane helix 79-101 LGAGAIAAGTVMLPLAIAVGGAW
Outside 102-145 ALDKVGVTGWLSKEFTQVGDALGLTIGRGDPHPACIGDRIAHSS
Transmembrane helix 146-168 GFMGILAGIAVGVAIGVAVAATV
Inside 169-172 ATGG
Transmembrane helix 173-195 LAGALIVGACMAGGLTLGSALAS
Outside 196-1494 ASQSMGSNCGEIVTGSSNVYFEGKKVARVTDLVKCDHHSGVPQALVDGSKTVFVNGLPLVRIGHETHCSGKVNSGRNSIWIDKTTGHYGPKNPELSATQEFLAGLLGGIVGGGVGKFAGKGLRGLREKFKPEPTRSAEQKGIKDENRPTCKDPVDPVSGEMLEIRTDLVIPGILPLEFKRRYRTRSDDHGLLGHRWSDNWSQQLTFDGGRFVRFHDGAGLVIGFDAPDMALNGINLREPRYRLVGSRLEPRIFDRDTRQLRIFAPLVDGRSSRLERIEDLDGNAIVLSYDIAGRLSGMAHSDGYRLEIVCHGRDRRLERIVLHDADGGSRTLVDYDYQNSMLTHVASFQFGQFYYAYDEHGWMTQWRDTDQTDVRYRYDTAGRVVETGTQQGYHTGRFIYEAGRTRVIDVDGEWTYDYNDEGLVTAETDPLGHCTRSEWELGRLMARIDPLGRRTDYRYDERGQLTSVVESSGRMVEFDYDDEQRLTGTRLPNGGRIRLEYDHLYRLIARTEPDGNRTAYRYGPRGELLRVVQGDRETRLDYDDRLRLTDIELPTGARFRRRIDVLGRLLEETSPDGHVTRYDYADGPANPRGLLSAITRPDGSVSRARYNSESLPVEWIDPLGRTIRRTYGPFDLLTASIDAAGHATRFEYDHATRLTKVINALGETYTYRYDAAGRLAAEIDWGGRATRYERDAVGRLLAKTLPDGGQWRYTYDASDRLVEIDAGDVKLAYRYDASGRLASAEVQGEHVHVTRFAYDRNGRLIGEDQHGELLRHVYDADGQRSLRLTPRRETAYAYDALGALTQVAGLTIRRDGLGREIGRQAGDFVAQQQYDALGRIRRQIAGPAVAFDALQADPARALEQLTRQVYHYDAAGQLERVDTGADTLTYQRDERGQIISAESLLQPSEHFRYDAVMNIAAHGQRAPVDAHHYRRGGLPEQVGYARYQYDARGRTIEKTVEQPGFRPKTWQYTWDGLNRLVKVVTPERGVWAYRYDAFNRRIEKQQVGGRETVRFLWDGPMLAERWIEQRDGTTGQVVTWHIEPGSFSPLAQETDSGIFSILTDQVGLPKAAFDEHGTTVWKGAYSLWGKPLPARRAANDAQGAAISIDTTLRFPGQWADDETGLCYNLNRYYDPDSGQYLSCDPIGLEGGFRTQGYVHAPDAWVDPLGLSGCEDVKEYDVVPYRPSNSPLENHHGVLDVWMAKNVPDYGGKYPIKSPTIALSAESHAATKAAYRDWLTMKTGRPVGGKVDWEAVSNREMQALSEQMFDAAKVPQASRDAYYRALNQYLYTGEFDPVKF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9119 - -



  Protein sequence: 1495 a.a.    .

>EFF76639 NC_008061:433352-437836 [Burkholderia cenocepacia AU 1054]
MSDTPNYNEPSGSAQERLDQIAGLEDGEAAKAAEQPFYEHLNYGMLGADAGLTAVEGTAAGLGAAGTALAGGATGGAALG
AGAIAAGTVMLPLAIAVGGAWALDKVGVTGWLSKEFTQVGDALGLTIGRGDPHPACIGDRIAHSSGFMGILAGIAVGVAI
GVAVAATVATGGLAGALIVGACMAGGLTLGSALASASQSMGSNCGEIVTGSSNVYFEGKKVARVTDLVKCDHHSGVPQAL
VDGSKTVFVNGLPLVRIGHETHCSGKVNSGRNSIWIDKTTGHYGPKNPELSATQEFLAGLLGGIVGGGVGKFAGKGLRGL
REKFKPEPTRSAEQKGIKDENRPTCKDPVDPVSGEMLEIRTDLVIPGILPLEFKRRYRTRSDDHGLLGHRWSDNWSQQLT
FDGGRFVRFHDGAGLVIGFDAPDMALNGINLREPRYRLVGSRLEPRIFDRDTRQLRIFAPLVDGRSSRLERIEDLDGNAI
VLSYDIAGRLSGMAHSDGYRLEIVCHGRDRRLERIVLHDADGGSRTLVDYDYQNSMLTHVASFQFGQFYYAYDEHGWMTQ
WRDTDQTDVRYRYDTAGRVVETGTQQGYHTGRFIYEAGRTRVIDVDGEWTYDYNDEGLVTAETDPLGHCTRSEWELGRLM
ARIDPLGRRTDYRYDERGQLTSVVESSGRMVEFDYDDEQRLTGTRLPNGGRIRLEYDHLYRLIARTEPDGNRTAYRYGPR
GELLRVVQGDRETRLDYDDRLRLTDIELPTGARFRRRIDVLGRLLEETSPDGHVTRYDYADGPANPRGLLSAITRPDGSV
SRARYNSESLPVEWIDPLGRTIRRTYGPFDLLTASIDAAGHATRFEYDHATRLTKVINALGETYTYRYDAAGRLAAEIDW
GGRATRYERDAVGRLLAKTLPDGGQWRYTYDASDRLVEIDAGDVKLAYRYDASGRLASAEVQGEHVHVTRFAYDRNGRLI
GEDQHGELLRHVYDADGQRSLRLTPRRETAYAYDALGALTQVAGLTIRRDGLGREIGRQAGDFVAQQQYDALGRIRRQIA
GPAVAFDALQADPARALEQLTRQVYHYDAAGQLERVDTGADTLTYQRDERGQIISAESLLQPSEHFRYDAVMNIAAHGQR
APVDAHHYRRGGLPEQVGYARYQYDARGRTIEKTVEQPGFRPKTWQYTWDGLNRLVKVVTPERGVWAYRYDAFNRRIEKQ
QVGGRETVRFLWDGPMLAERWIEQRDGTTGQVVTWHIEPGSFSPLAQETDSGIFSILTDQVGLPKAAFDEHGTTVWKGAY
SLWGKPLPARRAANDAQGAAISIDTTLRFPGQWADDETGLCYNLNRYYDPDSGQYLSCDPIGLEGGFRTQGYVHAPDAWV
DPLGLSGCEDVKEYDVVPYRPSNSPLENHHGVLDVWMAKNVPDYGGKYPIKSPTIALSAESHAATKAAYRDWLTMKTGRP
VGGKVDWEAVSNREMQALSEQMFDAAKVPQASRDAYYRALNQYLYTGEFDPVKF*

  Nucleotide sequence: 4485 bp    .

>EFF76639 NC_008061:433352-437836 [Burkholderia cenocepacia AU 1054]
ATGTCGGACACGCCGAACTACAACGAGCCGAGCGGCAGCGCCCAGGAGCGTCTCGATCAGATCGCCGGGCTGGAGGACGG
TGAAGCCGCGAAAGCGGCCGAGCAGCCGTTTTACGAGCACCTCAACTACGGGATGCTCGGCGCCGATGCGGGCCTGACCG
CCGTCGAGGGGACGGCCGCCGGGCTGGGTGCCGCCGGTACGGCGCTCGCGGGTGGGGCGACCGGCGGGGCGGCACTGGGC
GCGGGCGCGATTGCGGCGGGCACCGTCATGCTTCCGCTGGCGATTGCGGTCGGCGGTGCGTGGGCGCTCGACAAGGTTGG
CGTGACCGGCTGGCTATCGAAGGAATTCACGCAGGTTGGCGACGCGCTCGGCCTCACGATCGGTCGCGGCGATCCGCACC
CCGCCTGCATTGGCGATCGGATCGCGCACTCGTCGGGTTTTATGGGGATTCTCGCCGGCATTGCCGTGGGAGTCGCGATT
GGCGTGGCAGTGGCGGCGACCGTGGCAACCGGTGGACTCGCCGGCGCGCTGATCGTCGGCGCGTGCATGGCGGGCGGCCT
GACGCTGGGGAGTGCGCTCGCGTCGGCGAGCCAGAGCATGGGCAGCAACTGTGGCGAGATCGTCACCGGTTCGAGCAACG
TGTACTTCGAAGGCAAGAAGGTGGCGCGTGTCACGGACCTGGTGAAATGCGATCACCATTCCGGCGTGCCGCAGGCACTC
GTCGACGGCAGCAAGACCGTGTTCGTCAACGGTCTGCCGCTGGTGCGGATCGGCCACGAAACGCACTGTAGCGGCAAGGT
CAATTCGGGGCGCAACAGCATCTGGATCGACAAGACGACTGGACACTACGGTCCGAAGAACCCGGAGTTGTCCGCGACTC
AGGAATTCCTGGCGGGTTTGCTCGGCGGGATCGTAGGAGGCGGAGTCGGAAAATTTGCCGGCAAGGGGCTGCGGGGGTTG
CGCGAAAAATTCAAGCCTGAGCCCACCCGATCCGCGGAACAGAAGGGCATCAAGGACGAGAACCGGCCGACGTGCAAGGA
CCCGGTTGATCCGGTGTCCGGCGAAATGCTCGAGATCCGTACGGATCTCGTCATTCCCGGCATCCTGCCTCTCGAGTTCA
AGCGACGCTATCGGACTCGATCGGACGACCATGGATTGCTCGGTCACCGCTGGTCGGACAACTGGTCGCAACAACTGACG
TTCGATGGCGGCCGCTTCGTGAGATTCCACGACGGCGCCGGCCTGGTGATCGGCTTTGACGCGCCGGATATGGCGCTCAA
CGGCATCAACCTGCGCGAGCCGCGCTATCGGCTGGTCGGAAGCCGGCTCGAACCGCGCATCTTCGATCGCGATACGCGGC
AACTACGTATTTTCGCGCCGCTCGTCGATGGGCGTTCGTCTCGCCTCGAACGGATCGAGGACCTCGACGGTAACGCAATC
GTTCTCTCGTACGATATTGCCGGCCGTTTGAGTGGTATGGCCCATAGCGACGGCTATCGGCTCGAGATTGTTTGTCACGG
GCGCGACCGACGGCTGGAACGGATCGTTCTTCACGATGCGGACGGCGGTTCCCGGACACTCGTGGACTACGACTACCAGA
ACAGCATGCTTACCCACGTGGCGAGCTTCCAGTTTGGCCAGTTCTACTACGCGTATGACGAACACGGCTGGATGACCCAG
TGGCGGGATACGGACCAGACCGACGTTCGATATCGGTACGACACCGCTGGTCGTGTCGTCGAGACCGGCACGCAGCAGGG
TTATCACACAGGTCGGTTCATCTACGAGGCCGGTCGCACACGGGTGATCGATGTCGACGGAGAATGGACCTATGACTATA
ACGATGAAGGTCTCGTAACGGCCGAAACCGATCCGCTCGGCCATTGCACTCGCTCCGAATGGGAGCTTGGTCGCTTGATG
GCCCGGATCGATCCGCTGGGTCGACGGACGGACTATCGATACGACGAGCGTGGTCAACTGACTTCGGTCGTCGAAAGCTC
GGGGAGGATGGTCGAGTTCGACTATGACGACGAGCAGCGCCTTACCGGCACGCGTTTGCCGAACGGCGGCCGGATCAGGC
TCGAGTATGACCATCTGTATCGATTGATTGCTCGCACCGAGCCGGACGGCAACAGAACTGCCTATCGCTACGGCCCCCGA
GGCGAACTGCTGCGGGTGGTTCAGGGTGATCGCGAGACGCGCCTGGACTACGATGACCGGTTGCGGCTGACCGACATCGA
GTTGCCGACAGGTGCGCGCTTCAGGCGCAGGATAGACGTACTGGGTCGGCTGCTGGAGGAGACGTCGCCCGATGGGCACG
TGACGCGTTACGACTATGCTGACGGCCCGGCAAATCCGCGCGGTCTGCTGAGCGCGATCACGCGCCCCGATGGCTCGGTG
TCGAGGGCGCGATATAACAGCGAGAGCCTGCCCGTCGAGTGGATCGATCCGCTCGGACGTACGATCCGGCGAACCTATGG
CCCGTTCGATTTGCTTACGGCGTCGATCGACGCGGCCGGTCATGCAACGCGTTTCGAGTACGACCATGCCACCCGGCTGA
CGAAGGTCATCAATGCTCTGGGAGAGACTTACACGTACCGCTACGACGCGGCCGGGCGTCTCGCGGCCGAGATCGACTGG
GGCGGCCGCGCGACTCGATATGAGCGCGATGCCGTCGGCCGCCTGCTGGCGAAGACACTGCCCGACGGTGGCCAGTGGCG
CTATACGTACGATGCATCCGACCGGCTCGTCGAGATCGATGCCGGCGACGTGAAGCTTGCTTACCGCTACGATGCGAGCG
GACGACTGGCGTCGGCGGAGGTCCAGGGCGAGCACGTTCACGTGACGCGCTTTGCCTACGACAGGAATGGCCGCTTGATC
GGAGAAGATCAGCATGGCGAACTGTTGAGGCACGTCTACGACGCGGACGGCCAGCGGAGCCTTCGGCTGACGCCTCGGCG
GGAGACGGCCTATGCCTATGATGCATTGGGTGCGCTCACGCAGGTCGCCGGGCTGACGATCCGGCGCGATGGCTTAGGGC
GCGAGATCGGGCGGCAGGCGGGAGATTTTGTCGCGCAGCAACAGTACGATGCGCTCGGCCGTATACGCCGGCAGATTGCA
GGGCCTGCCGTAGCCTTCGATGCGTTGCAAGCCGATCCGGCCCGGGCGCTCGAGCAATTGACGCGGCAGGTCTATCACTA
CGACGCAGCCGGACAACTGGAGCGAGTGGACACCGGCGCGGATACGCTCACCTACCAGCGCGATGAGCGCGGCCAGATCA
TCTCCGCAGAAAGTCTGCTGCAGCCAAGCGAGCACTTCCGCTATGACGCTGTGATGAACATTGCCGCGCACGGGCAACGG
GCACCTGTGGATGCCCACCACTATCGCCGCGGAGGTCTGCCGGAACAGGTTGGCTACGCACGCTATCAATACGATGCACG
TGGCCGCACGATCGAGAAGACGGTCGAACAGCCGGGGTTCAGGCCGAAAACGTGGCAATACACGTGGGATGGCCTCAATC
GGCTCGTGAAGGTCGTTACGCCCGAGCGCGGTGTTTGGGCGTATCGCTATGACGCTTTCAATCGCCGGATCGAGAAGCAG
CAAGTCGGCGGCCGTGAAACGGTGAGGTTCCTGTGGGACGGTCCGATGCTTGCCGAGCGCTGGATCGAGCAGCGGGATGG
TACGACGGGCCAAGTCGTGACCTGGCATATCGAGCCGGGCAGTTTCTCGCCGCTCGCGCAGGAGACCGACAGCGGTATCT
TTTCAATTCTGACGGACCAGGTCGGTTTGCCAAAGGCGGCGTTCGACGAACATGGCACGACTGTGTGGAAGGGGGCGTAC
TCGCTGTGGGGGAAACCGCTGCCGGCCAGACGAGCAGCGAACGATGCGCAGGGCGCGGCAATTTCAATCGATACGACGTT
GCGTTTTCCCGGTCAATGGGCCGACGACGAGACGGGACTGTGCTACAACCTGAATCGATACTACGATCCAGATTCAGGGC
AGTATCTTAGTTGCGATCCGATTGGCCTTGAAGGTGGATTTAGAACGCAAGGCTATGTGCACGCGCCAGACGCGTGGGTT
GATCCGCTGGGATTGAGCGGCTGCGAGGACGTTAAAGAGTACGATGTTGTTCCATATCGACCAAGCAATTCGCCTTTAGA
AAACCACCATGGAGTACTCGATGTATGGATGGCCAAGAATGTTCCAGATTACGGTGGGAAATATCCGATTAAATCGCCAA
CAATTGCTTTGTCCGCTGAGTCGCATGCTGCGACAAAGGCTGCGTACCGAGATTGGTTGACTATGAAAACCGGGCGCCCA
GTTGGTGGAAAAGTTGATTGGGAAGCCGTAAGCAATCGAGAAATGCAGGCGCTGTCCGAGCAAATGTTTGATGCTGCAAA
AGTTCCGCAGGCGAGCAGGGATGCGTACTACAGGGCGTTGAATCAGTATTTGTACACGGGTGAGTTTGATCCGGTGAAAT
TTTAG