Detailed information of effector


Summary

Effector ID EFF76634 experimental
Effector type Tpe/Tge
Cognate immunity protein IMU38209 experimental
Related T6SS (Type) T6SS01046 experimental (Type i4b)
Strain Acinetobacter baumannii strain ATCC 17978
Replicon chromosome
Sequence Protein sequence (813 a.a.); Nucleotide sequence (2439 bp)
Description Tse4 exhibits both lytic transglycosylase and endopeptidase activity in vitro.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACX60_00605 (Tse4)
Coordinates (Strand) 131270..133708 (+)
NCBI ID WP_049594793.1
RefSeq NZ_CP012004
Uniprot ID UPI00065F6710
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Peptidase_M23 PF01551.24 7.1e-12 666..777
LysM PF01476.22 2.4e-11 5..48

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-812 MSNIHIVKKGDTLWGISNKYHIKLNELIEINGLYGRKKNLLKIGQQIYLKKDNVKKYDTTLVIKIYDLKWEPITHGKLLLEYDDKCHLATSNDKGVIEDIQIEDALKGIKISFYTLKNKFELIAHHKTLPLGKKILKLSSRAMMIKGNTYKVEGIPRTNTKTIEKELKVNSKKVQHSSGASGASGASGASGASGASGASGASGASGASGASGASGASETRIEGGLPAVTVAPVYSEENLYLHPDNEKYRKIIIDAAKKYNLAPQALAAKINAEAGTKKGSQEWNPQAQASTSSAVGLTQFLSGTWYEICTVSTYKDTLLQQYVIKKKLISNFKENMALKLISNTDKAKLKALGTDPTFSVDSAAAYARANINIVKKIYSKIDSLEPGDLAKVGYVAHHDGPTGFGKIVEATNDPSWSKLQGQVCPKNNPNCDTYLNYKERFSNGRDAYRWWLCTEYTDSKINVNRFTLSPKDGKKFKNARTMEEIIVFLGGKPLVRPSRDFEKKGTTDNSKLNDNINIVITSLVNNKVQANISYFVKSKYGLKPHSTNVNGHEIIHAKKGDKIEILFNDQVIASINAINDKEEFKINFPSKNITNASTEKQSSNSEQKLNFNRWRNPLNGICQIRRFGYNSLPLKANASSYNEKNLEQATKIASRFNRTSYRASGIHQGVDLEADNGVNIYPVCVGTIAKVIPAYPGYGKTIILECDVNDLPSSKKVLAKNLDTIYFIYAHLNSINVSEGDSITTLDTVLGKTGNSGNAGSMTRIEDGSHLHFEVRSEIMKSMGKSGMSYRLDPFPWLDNCMTTENGVKVNR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9984 - -



  Protein sequence: 813 a.a.    .

>EFF76634 NZ_CP012004:131270-133708 [Acinetobacter baumannii]
MSNIHIVKKGDTLWGISNKYHIKLNELIEINGLYGRKKNLLKIGQQIYLKKDNVKKYDTTLVIKIYDLKWEPITHGKLLL
EYDDKCHLATSNDKGVIEDIQIEDALKGIKISFYTLKNKFELIAHHKTLPLGKKILKLSSRAMMIKGNTYKVEGIPRTNT
KTIEKELKVNSKKVQHSSGASGASGASGASGASGASGASGASGASGASGASGASGASETRIEGGLPAVTVAPVYSEENLY
LHPDNEKYRKIIIDAAKKYNLAPQALAAKINAEAGTKKGSQEWNPQAQASTSSAVGLTQFLSGTWYEICTVSTYKDTLLQ
QYVIKKKLISNFKENMALKLISNTDKAKLKALGTDPTFSVDSAAAYARANINIVKKIYSKIDSLEPGDLAKVGYVAHHDG
PTGFGKIVEATNDPSWSKLQGQVCPKNNPNCDTYLNYKERFSNGRDAYRWWLCTEYTDSKINVNRFTLSPKDGKKFKNAR
TMEEIIVFLGGKPLVRPSRDFEKKGTTDNSKLNDNINIVITSLVNNKVQANISYFVKSKYGLKPHSTNVNGHEIIHAKKG
DKIEILFNDQVIASINAINDKEEFKINFPSKNITNASTEKQSSNSEQKLNFNRWRNPLNGICQIRRFGYNSLPLKANASS
YNEKNLEQATKIASRFNRTSYRASGIHQGVDLEADNGVNIYPVCVGTIAKVIPAYPGYGKTIILECDVNDLPSSKKVLAK
NLDTIYFIYAHLNSINVSEGDSITTLDTVLGKTGNSGNAGSMTRIEDGSHLHFEVRSEIMKSMGKSGMSYRLDPFPWLDN
CMTTENGVKVNR*

  Nucleotide sequence: 2439 bp    .

>EFF76634 NZ_CP012004:131270-133708 [Acinetobacter baumannii]
ATGAGTAATATACATATAGTCAAAAAAGGTGATACTCTTTGGGGTATCTCAAATAAATACCACATCAAGCTTAATGAATT
AATTGAAATTAATGGATTATATGGCAGAAAGAAAAATTTACTAAAAATCGGACAACAGATATATCTAAAAAAAGACAATG
TTAAAAAATATGATACAACTTTAGTGATTAAAATTTATGATTTGAAATGGGAGCCGATTACCCATGGTAAATTATTGCTA
GAGTATGATGACAAATGTCATTTAGCGACTAGTAATGATAAAGGAGTAATAGAAGATATCCAAATTGAAGATGCTTTGAA
AGGAATAAAAATAAGCTTTTATACATTAAAAAATAAATTTGAGCTTATAGCTCATCATAAAACATTGCCATTAGGTAAAA
AAATACTAAAGCTAAGTTCTCGTGCAATGATGATAAAAGGTAATACTTATAAAGTTGAGGGTATACCTAGAACGAATACA
AAAACAATTGAAAAAGAATTGAAAGTTAATAGTAAGAAAGTGCAGCATTCATCTGGAGCATCTGGAGCATCTGGAGCATC
TGGAGCATCTGGAGCATCTGGAGCATCTGGAGCATCTGGAGCATCTGGAGCATCTGGAGCATCTGGAGCATCTGGAGCAT
CTGGAGCATCTGAGACAAGAATAGAAGGAGGGCTACCTGCGGTTACAGTAGCTCCAGTGTACTCAGAAGAAAATTTATAT
TTACATCCAGATAATGAAAAATATCGAAAAATAATTATCGACGCGGCAAAAAAATATAATTTAGCGCCACAAGCCTTGGC
TGCAAAAATTAATGCGGAAGCAGGAACAAAAAAAGGTAGCCAAGAATGGAATCCTCAAGCACAAGCTTCGACATCATCAG
CAGTAGGTTTGACCCAGTTTTTAAGCGGAACTTGGTATGAGATATGTACAGTTTCTACTTATAAAGACACCTTACTCCAA
CAATATGTTATTAAGAAAAAATTAATCTCTAATTTTAAAGAGAACATGGCACTTAAATTAATTTCGAATACAGATAAAGC
AAAATTAAAAGCACTTGGGACTGACCCTACATTTTCTGTAGATTCTGCTGCCGCATATGCAAGAGCAAATATAAATATTG
TTAAGAAAATATATAGTAAAATTGATAGCCTTGAACCAGGGGATCTCGCAAAAGTTGGCTATGTAGCACATCATGATGGT
CCAACAGGATTTGGTAAAATAGTTGAAGCTACAAATGATCCTTCATGGTCGAAATTACAAGGACAAGTGTGTCCAAAAAA
TAATCCAAATTGCGATACTTATCTCAATTATAAAGAGAGGTTCAGCAATGGTAGAGATGCATATCGTTGGTGGTTATGTA
CTGAATATACAGATTCAAAAATTAATGTTAATCGATTTACGCTTAGTCCAAAGGACGGTAAAAAATTTAAGAATGCTCGA
ACAATGGAAGAAATTATTGTCTTTTTAGGTGGTAAACCTTTAGTTCGGCCAAGTAGAGATTTTGAAAAAAAGGGTACAAC
TGATAATTCAAAGCTAAATGATAATATCAATATTGTTATTACTTCTCTTGTAAATAATAAAGTACAAGCTAATATCTCTT
ATTTTGTAAAATCTAAATACGGGCTAAAACCTCACTCAACAAATGTAAATGGTCATGAAATTATACATGCTAAAAAGGGT
GATAAAATTGAAATTCTTTTTAATGATCAAGTTATAGCTTCAATAAATGCAATAAATGACAAAGAGGAGTTTAAAATTAA
TTTCCCCTCTAAGAATATAACTAATGCATCAACAGAAAAGCAAAGCTCTAACAGCGAACAAAAATTAAATTTCAATAGAT
GGAGAAATCCTCTAAATGGTATTTGCCAAATAAGAAGATTTGGCTATAACTCATTACCATTAAAAGCAAATGCTAGCTCG
TATAATGAAAAAAATTTAGAACAAGCAACAAAAATTGCATCGAGATTTAATCGTACAAGCTATAGGGCTAGTGGTATTCA
TCAGGGAGTAGATTTAGAAGCTGATAATGGAGTTAATATTTATCCCGTTTGTGTGGGTACTATCGCAAAAGTAATTCCCG
CATATCCTGGTTATGGGAAAACAATTATTTTAGAATGTGATGTAAATGATTTACCTAGTTCAAAAAAAGTCTTAGCAAAA
AATTTAGACACAATTTACTTTATTTATGCACATTTAAATTCTATAAATGTATCGGAAGGAGATAGTATAACGACTCTCGA
TACAGTTTTAGGAAAAACGGGTAATAGTGGTAATGCTGGGAGTATGACTAGAATTGAAGATGGTTCCCATTTACATTTTG
AAGTGCGTTCTGAAATAATGAAATCAATGGGTAAATCTGGAATGTCTTATAGATTAGATCCATTCCCATGGCTAGATAAT
TGTATGACAACTGAAAATGGTGTTAAAGTAAATAGGTAA