Detailed information of effector


Summary

Effector ID EFF28267 experimental
Effector type -
Cognate immunity protein IMU38223 experimental
Related T6SS (Type) T6SS01034 experimental (Type i1)
Strain Escherichia coli PCN033
Replicon chromosome
Sequence Protein sequence (1385 a.a.); Nucleotide sequence (4155 bp)
Description By detecting the cytotoxicity of these Rhs proteins, in the IPTG-induced group, the survival rates of Rhs-1CT, Rhs-2CT, and Rhs-3CT decreased significantly. Bacteria competition assay shown that Δrhs-1CT, Δrhs-3CT, and Δrhs-4CT play important roles in bacterial competition. After the deletion of rhs-1CT, rhs-2CT, rhs-3CT and rhs-4CT, bacteria adhesion and invasion ability to HBMECs were significantly reduced.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PPECC33_RS07930 (Rhs2)
Coordinates (Strand) 1615760..1619914 (+)
NCBI ID WP_047938343.1
RefSeq NZ_CP006632
Uniprot ID UPI00064CDBF8
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 1.2e-17 46..123
RHS PF03527.16 3.6e-16 1152..1189
Tox-WTIP PF15654.8 5e-14 1341..1384
RHS_repeat PF05593.16 1.9e-10 579..615
RHS_repeat PF05593.16 3.6e-07 539..572
RHS_repeat PF05593.16 5.9e-06 365..395
RHS_repeat PF05593.16 8.4e-06 641..678
RHS_repeat PF05593.16 3.9e-05 413..444
RHS_repeat PF05593.16 5.7e-05 320..357

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1384 MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTSGNPVNPLLGAKVLPGETDVALPGPLPFILSRTYSSYRTKTPAPVGVFGPGWKAPSDIRLQLRDDGLILNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALSPDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGLADRFGRTLTYRREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARTSSLSSSDRSRPLSASAFPDTLPGTEYGPDRGIRLSAVWLMHDPAYPESLPGAPLVRYTYTEAGELLAVYDRSNTQVRAFTYDAQHPGRMVAHRYAGRPEMRYRYDDAGRVVEQLNPAGLSYRYQYEQDRITVTDSLNRREVLHTEGGAGLKRVVKKELADGSVTRSGYDPVGRLTAQTDAAGRRTEYGLNVVSGDITDITTPDGRETKFYYNDGNLVTAVVYPDGLESRRAYDERDRLVSETSRSGDVIRYAYDNPHSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREDGISLYRRYDNRGRLTSVKDAQGRETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQGGLTRSMEYDAAGRVATLTNENGSDSAFSYDALDRLVQQGGFDGRTQRYHYDLTGKLTQSEDEGLVILWYYDESDRLTHRTVNGEPAEQWQYDGHGWLREISHLSEGHRVAVHYGYDDKGRLTSERQTLKNPETGELLWQHETKQAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSFGSMAGSNSAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTLAPDLDIRIPYATDPAGNRLPDPELHPDSTLTVWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYDSQHRLVFYTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEVTWYGWDGDHLTTVQTDSTRIQTVYEPGSFTPLIRIETDNGEREKTQRRSLAEKLQQEGSEDGHSVVFPAELVRLLDRLEGEIRADRVSSESRAWLAQCGLTVEQLEKQVEPEYTPARKVHLYHCDHRGLPLALISEDGNTAWSGEYDEWGNLLNEENPHHLHQPYRLPGQQHDEESGLYYNRHRYYDPLQGRYIIQDPIGLAGGINPYSYVMNNPVQWIDPLGLAHTSGKWKDCGKGCRIRIDGDAVGDGRHLHWECKNGSGVMGEFGGMSHGEDYSSAPNSIKKCAKKYGFEPEPSKDLSCKTSGLSTTDAALATGATIGAGYVIYRVIRFIPSLAPPLWWSIPANVVTP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6031 - -



  Protein sequence: 1385 a.a.    .

>EFF28267 NZ_CP006632:1615760-1619914 [Escherichia coli PCN033]
MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTSGNPVNPLLGAKVLPGETDVALPGPLPFILSRTYSS
YRTKTPAPVGVFGPGWKAPSDIRLQLRDDGLILNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWG
ALSPDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGLADRFGRTLTYRREAAGDLAGEITGVTDG
AGREFRLVLTTQAQRAEEARTSSLSSSDRSRPLSASAFPDTLPGTEYGPDRGIRLSAVWLMHDPAYPESLPGAPLVRYTY
TEAGELLAVYDRSNTQVRAFTYDAQHPGRMVAHRYAGRPEMRYRYDDAGRVVEQLNPAGLSYRYQYEQDRITVTDSLNRR
EVLHTEGGAGLKRVVKKELADGSVTRSGYDPVGRLTAQTDAAGRRTEYGLNVVSGDITDITTPDGRETKFYYNDGNLVTA
VVYPDGLESRRAYDERDRLVSETSRSGDVIRYAYDNPHSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDR
FGQMTAVHREDGISLYRRYDNRGRLTSVKDAQGRETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQGGLTRSME
YDAAGRVATLTNENGSDSAFSYDALDRLVQQGGFDGRTQRYHYDLTGKLTQSEDEGLVILWYYDESDRLTHRTVNGEPAE
QWQYDGHGWLREISHLSEGHRVAVHYGYDDKGRLTSERQTLKNPETGELLWQHETKQAYNEQGLANRVTPDSLPPVEWLT
YGSGYLAGMKLGGTPLVEYTRDRLHRETVRSFGSMAGSNSAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRIS
GPRQTREYGYSATGRLESVRTLAPDLDIRIPYATDPAGNRLPDPELHPDSTLTVWPDNRIAEDAHYVYRHDEYGRLTEKT
DRIPAGVIRTDDERTHHYDSQHRLVFYTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEVTWYGWDG
DHLTTVQTDSTRIQTVYEPGSFTPLIRIETDNGEREKTQRRSLAEKLQQEGSEDGHSVVFPAELVRLLDRLEGEIRADRV
SSESRAWLAQCGLTVEQLEKQVEPEYTPARKVHLYHCDHRGLPLALISEDGNTAWSGEYDEWGNLLNEENPHHLHQPYRL
PGQQHDEESGLYYNRHRYYDPLQGRYIIQDPIGLAGGINPYSYVMNNPVQWIDPLGLAHTSGKWKDCGKGCRIRIDGDAV
GDGRHLHWECKNGSGVMGEFGGMSHGEDYSSAPNSIKKCAKKYGFEPEPSKDLSCKTSGLSTTDAALATGATIGAGYVIY
RVIRFIPSLAPPLWWSIPANVVTP*

  Nucleotide sequence: 4155 bp    .

>EFF28267 NZ_CP006632:1615760-1619914 [Escherichia coli PCN033]
ATGAGCGGAAAACCAGCGGCGCGTCAGGGAGATATGACTCAGTATGGCGGTCCCATTGTCCAGGGTTCGGCAGGTGTAAG
AATTGGCGCGCCCACCGGCGTGGCGTGCTCGGTGTGTCCGGGCGGGATGACTTCGGGCAACCCGGTAAATCCGCTGCTGG
GGGCGAAGGTGCTGCCCGGCGAGACGGATGTTGCGCTGCCCGGCCCGCTGCCGTTCATTCTCTCCCGCACCTACAGCAGC
TACCGGACGAAGACGCCTGCGCCGGTGGGCGTTTTCGGCCCCGGCTGGAAAGCGCCTTCTGATATCCGCTTACAGCTACG
TGATGACGGACTGATACTCAACGACAACGGCGGGCGGAGCATTCACTTTGAGCCGCTGCTGCCGGGGGAGGCGGTGTACA
GCCGCAGCGAGTCAATGTGGCTGGTTCGCGGTGGTAAGGCAGCGCAGCCGGACGGCCACACGCTGGCGCGGCTGTGGGGG
GCGCTGTCGCCGGATATCCGGTTAAGCCCGCATCTTTACCTGGCGACCAACAGCGCACAGGGACCGTGGTGGATACTGGG
GTGGTCTGAGCGGGTGCCGGGTGCTGAGGACGTACTGCCAGCGCCGCTGCCGCCGTACCGGGTGCTTACCGGGCTGGCGG
ACCGCTTCGGGCGGACGCTGACGTACCGGCGTGAGGCCGCCGGTGACCTGGCCGGGGAAATCACCGGCGTGACGGACGGT
GCCGGGCGGGAGTTCCGTCTGGTGCTGACCACGCAGGCGCAGCGTGCGGAAGAGGCCCGCACCTCTTCGCTATCTTCTTC
TGACCGTTCCCGCCCTCTCTCAGCCTCAGCGTTCCCCGACACACTGCCCGGTACCGAATACGGCCCCGACAGGGGCATCC
GTCTTTCGGCGGTGTGGCTGATGCACGACCCGGCATACCCGGAGAGCCTGCCCGGTGCGCCACTGGTGCGGTACACGTAT
ACGGAAGCCGGTGAACTGCTGGCGGTATATGACCGCAGCAATACGCAGGTGCGCGCTTTCACGTATGACGCGCAGCACCC
GGGCCGGATGGTGGCGCACCGTTACGCGGGAAGGCCGGAGATGCGCTACCGCTACGACGATGCGGGGCGGGTGGTGGAGC
AGCTGAACCCGGCAGGCCTGAGTTACCGCTACCAGTATGAGCAGGACCGCATCACCGTCACGGACAGCCTGAACCGGCGT
GAGGTGCTGCATACAGAAGGCGGGGCCGGGCTGAAGCGGGTGGTGAAAAAAGAACTGGCGGACGGCAGCGTCACGCGCAG
CGGGTATGACCCGGTGGGGCGGCTTACGGCGCAGACGGACGCGGCGGGACGGCGGACAGAGTACGGTCTGAATGTGGTGT
CAGGCGACATCACGGACATCACCACGCCGGACGGGCGGGAGACGAAATTTTACTATAACGACGGGAACCTGGTGACGGCG
GTGGTGTACCCGGACGGGCTGGAGAGCCGCCGGGCGTATGATGAGCGGGACAGGCTGGTATCGGAGACATCGCGCAGTGG
GGACGTCATCCGGTATGCTTATGATAATCCGCACAGTGAATTACCGGCCACGACAACAGATGCGACGGGCAGCACCCGGC
AGATGACGTGGAGCCGCTACGGTCAGTTACTGGCGTTCACCGACTGCTCGGGCTACCAGACCCGCTATGAATACGACCGC
TTTGGTCAGATGACGGCGGTCCACCGTGAGGATGGCATCAGCCTTTACCGCCGCTATGACAACCGTGGCCGGTTAACCTC
GGTGAAAGACGCACAGGGCCGTGAAACGCGGTATGAATACAACGCCGCAGGCGACCTGACTGCCGTTATCACCCCGGACG
GCAACCGGAGCGAGACACAGTACGATGCGTGGGGAAAGGCGGTCAGCACCACGCAGGGCGGGCTGACGCGCAGTATGGAG
TATGACGCGGCAGGGCGTGTCGCCACGCTGACCAACGAGAACGGCAGTGACAGCGCCTTCAGCTACGATGCACTGGACCG
GCTGGTACAGCAGGGCGGCTTTGACGGGCGGACGCAACGTTATCATTATGACCTGACCGGAAAACTCACGCAGAGTGAAG
ATGAGGGGCTTGTCATCCTCTGGTACTACGATGAATCGGACCGCCTCACTCACCGCACGGTGAACGGCGAACCGGCAGAG
CAGTGGCAGTATGATGGCCACGGCTGGCTGAGAGAAATCAGCCACCTGAGCGAAGGCCACCGTGTGGCGGTCCACTACGG
CTATGACGATAAAGGCCGTCTGACCAGTGAGCGCCAGACGTTGAAGAACCCGGAGACGGGGGAACTGCTGTGGCAGCATG
AGACGAAACAGGCATACAACGAACAGGGGCTGGCAAACCGCGTCACGCCGGACAGCCTGCCGCCGGTGGAGTGGCTGACG
TATGGCAGCGGTTACCTGGCGGGAATGAAGCTGGGCGGGACGCCGCTGGTCGAGTATACGCGGGACAGGCTGCACCGTGA
GACGGTGCGCAGCTTCGGCAGCATGGCAGGCAGTAATTCCGCATATGAACTGACCAGCACATACACCCCCGCAGGTCAGT
TACAGAGTCAGCACCTGAACAGCCTGGTGTATGACCGTGACTACGGGTGGAATGACAACGGCGACCTGGTGCGCATCAGC
GGCCCGCGACAGACGCGGGAATACGGCTACAGCGCCACGGGCAGGCTGGAGAGCGTGCGCACCCTCGCACCGGACCTGGA
CATCCGCATCCCGTATGCCACGGACCCGGCGGGCAACCGGCTGCCGGACCCGGAGCTGCACCCGGACAGTACACTCACAG
TGTGGCCGGATAACCGCATCGCGGAGGATGCGCACTATGTCTACCGCCACGATGAATACGGCAGGCTGACGGAGAAGACG
GACCGCATCCCGGCGGGTGTGATACGGACGGACGACGAGCGGACCCACCACTACGACAGCCAGCACCGCCTGGTGTTCTA
CACGCGGATACAGCATGGAGAGCCACTGGTCGAGAGCCGCTACCTCTACGACCCGCTGGGACGGCGAATGGCGAAACGGG
TATGGCGGCGGGAGCGTGACCTGACGGGGTGGATGTCGCTGTCGCGTAAACCGGAGGTGACGTGGTACGGCTGGGACGGC
GACCACCTGACGACGGTGCAGACCGACAGCACACGTATCCAGACGGTATACGAGCCGGGAAGCTTCACACCGCTCATCCG
CATCGAAACAGACAACGGCGAGCGGGAGAAAACGCAGCGGCGGAGCCTGGCGGAGAAGCTCCAGCAGGAAGGGAGCGAGG
ACGGACACAGCGTGGTGTTCCCGGCTGAACTGGTGCGGCTGCTGGACAGGCTGGAGGGGGAAATCCGGGCAGACCGCGTG
AGCAGTGAAAGCCGGGCGTGGCTTGCGCAGTGCGGGCTGACGGTGGAGCAACTGGAAAAACAGGTGGAGCCGGAATACAC
ACCGGCGCGAAAAGTTCATCTTTACCACTGCGACCACCGGGGCCTGCCGCTGGCGCTCATCAGCGAAGACGGAAATACGG
CGTGGAGCGGGGAGTATGATGAATGGGGCAACCTGCTGAATGAGGAAAACCCGCATCACCTGCACCAGCCGTACCGTCTG
CCAGGGCAGCAACACGATGAGGAGTCGGGGCTGTATTATAACCGTCACCGGTACTACGATCCGTTGCAGGGGCGGTATAT
CATCCAGGACCCGATAGGGCTGGCGGGGGGAATAAACCCGTACAGTTATGTTATGAACAATCCTGTGCAATGGATTGATC
CATTGGGATTAGCTCATACTTCAGGAAAATGGAAGGACTGTGGTAAAGGTTGTCGAATCCGAATAGATGGCGATGCTGTT
GGTGACGGAAGACATTTGCATTGGGAGTGTAAAAATGGGAGTGGTGTAATGGGGGAATTTGGAGGTATGTCCCATGGTGA
GGATTACTCATCAGCACCAAATAGCATTAAGAAATGTGCAAAAAAATATGGTTTCGAGCCAGAACCAAGTAAAGATCTGT
CATGCAAAACCTCCGGGCTATCAACTACTGATGCGGCTCTTGCAACTGGTGCTACAATTGGCGCAGGGTATGTTATATAT
AGAGTGATTCGATTTATACCTTCACTTGCACCACCTCTTTGGTGGTCAATACCTGCAAACGTTGTTACTCCATGA