Detailed information of effector


Summary

Effector ID EFF28264 experimental
Effector type -
Cognate immunity protein IMU38222 experimental
Related T6SS (Type) T6SS01034 experimental (Type i1)
Strain Escherichia coli PCN033
Replicon chromosome
Sequence Protein sequence (1392 a.a.); Nucleotide sequence (4176 bp)
Description By detecting the cytotoxicity of these Rhs proteins, in the IPTG-induced group, the survival rates of Rhs-1CT, Rhs-2CT, and Rhs-3CT decreased significantly. Bacteria competition assay shown that Δrhs-1CT, Δrhs-3CT, and Δrhs-4CT play important roles in bacterial competition. After the deletion of rhs-1CT, rhs-2CT, rhs-3CT and rhs-4CT, bacteria adhesion and invasion ability to HBMECs were significantly reduced.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PPECC33_RS03580 (Rhs3)
Coordinates (Strand) 774741..778916 (+)
NCBI ID WP_047938335.1
RefSeq NZ_CP006632
Uniprot ID UPI00064C79EC
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 1.4e-17 46..123
RHS PF03527.16 1.7e-13 1139..1175
RHS_repeat PF05593.16 3.9e-09 571..607
RHS_repeat PF05593.16 3.1e-08 633..670
RHS_repeat PF05593.16 1.7e-07 935..980
RHS_repeat PF05593.16 1.2e-06 421..459
RHS_repeat PF05593.16 3.5e-06 531..564
RHS_repeat PF05593.16 1.2e-05 464..499
RHS_repeat PF05593.16 3e-05 357..387

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1391 MSGKPAARQGDMTQYGGSIVQGSAGVRIGAPTGVACSVCPGGVTSGHPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTKTPAPVGSLGPGWKMPADIRLQLRDNTLILSDNGGRSLYFEHLFPGEDGYSRSESLWLVRGGVAKLDEGHRLAALWQALPEELRLSPHRYLATNSPQGPWWVLGWCERVPEADEVLPAPLPPYRVLTGLVDRFGRTQTFHREAGGEFSGVTDGAGRHFRLVLTTQAQRAEEARQQAISGGTEPSAFPDTLPGYTEYGRDNGIRLSAVWLTHDPEYPDNLPAAPLVRYGWTPRGELAAVYDRSNTQVRSFTYDDKYRGRMVAHRHTGRPEIRYRYDSDGRVTEQLNPAGLSYTYQYEKDRITITDSLDRREVLHTQGEGGLKRVVKKEHADGSVTQSQFDAVGRLKAQTDAAGRTTEYSPDVVTGLITRITTPDGRASAFYYNHHSQLTSATGTDGLEIRWEYDESGRLIQETAPDGDITRYRYDNPHSDLPCATEDATGSRKTMTWSRYGQLLTVTDCSGYVTRYDHDRFGQVTAVHREEGLSQYRAYDSRGQLIAVKDMQGHETRYEYNAAGDLTAVIAPDGSRNGTQYDAWGKAIRTTQGGLTRSMEYDAAGRVIRLTSENGSHTTFRYDVLDRLIQETGFDGRTQRYHHDLTGKLIRSEDEGLVTHWHYDEADRLTHRTVKGEPAEQWQYDERGWLTQISHLSEGHRVTVHYGYDEKGRLTGERQTVHHPQTEALLWQHETRHAYNAQGLANRCIPDSLPAVEWLTYGSGWLSGMKLGDTPLVDFTRDRLHRETLRSFGRYELTTAYTPAGQLQSQHLNSLQYDRDYTWNDNGELIRISSPRQTRSYSYSDSGRLTGVHTTAANLDIRIPYATDPAGNRLPDPELHPDSTLSMWPDNRIARDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHQYHYDSQHRLVHYTRTQYAEPLVESRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPEVTWYGWDGDRLTTIQNDRTRIQTVYQPGSFTPLIRVETATGELAKTQRRSLADALQQSGGEDGGDVVFPPVLVQMLDRLESEILTDRVSEESRRWLASCGLTVEQMQNQMDPVYTPARKIHLYHCDHRGLPLALVSTEGATEWYAEYDEWGNQLSEDNPHQLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGLEGGWNQYVYASIHPTYSIDPLGLIDKPAPVFNRELNSDAYYLAVNNCYSYALNRYGNPGSRNFGGGGLQPGELSGKEFSKLTCSSIFEASKNDGAKDLDNGSCPSGYHKAQLFIRPHNFIGMGGDYHWYRQDANGEWSDKQGVGAIRFRGKDPLPPIDYPEKCGTICLPN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.5624 - -



  Protein sequence: 1392 a.a.    .

>EFF28264 NZ_CP006632:774741-778916 [Escherichia coli PCN033]
MSGKPAARQGDMTQYGGSIVQGSAGVRIGAPTGVACSVCPGGVTSGHPVNPLLGAKVLPGETDLALPGPLPFILSRTYSS
YRTKTPAPVGSLGPGWKMPADIRLQLRDNTLILSDNGGRSLYFEHLFPGEDGYSRSESLWLVRGGVAKLDEGHRLAALWQ
ALPEELRLSPHRYLATNSPQGPWWVLGWCERVPEADEVLPAPLPPYRVLTGLVDRFGRTQTFHREAGGEFSGVTDGAGRH
FRLVLTTQAQRAEEARQQAISGGTEPSAFPDTLPGYTEYGRDNGIRLSAVWLTHDPEYPDNLPAAPLVRYGWTPRGELAA
VYDRSNTQVRSFTYDDKYRGRMVAHRHTGRPEIRYRYDSDGRVTEQLNPAGLSYTYQYEKDRITITDSLDRREVLHTQGE
GGLKRVVKKEHADGSVTQSQFDAVGRLKAQTDAAGRTTEYSPDVVTGLITRITTPDGRASAFYYNHHSQLTSATGTDGLE
IRWEYDESGRLIQETAPDGDITRYRYDNPHSDLPCATEDATGSRKTMTWSRYGQLLTVTDCSGYVTRYDHDRFGQVTAVH
REEGLSQYRAYDSRGQLIAVKDMQGHETRYEYNAAGDLTAVIAPDGSRNGTQYDAWGKAIRTTQGGLTRSMEYDAAGRVI
RLTSENGSHTTFRYDVLDRLIQETGFDGRTQRYHHDLTGKLIRSEDEGLVTHWHYDEADRLTHRTVKGEPAEQWQYDERG
WLTQISHLSEGHRVTVHYGYDEKGRLTGERQTVHHPQTEALLWQHETRHAYNAQGLANRCIPDSLPAVEWLTYGSGWLSG
MKLGDTPLVDFTRDRLHRETLRSFGRYELTTAYTPAGQLQSQHLNSLQYDRDYTWNDNGELIRISSPRQTRSYSYSDSGR
LTGVHTTAANLDIRIPYATDPAGNRLPDPELHPDSTLSMWPDNRIARDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERT
HQYHYDSQHRLVHYTRTQYAEPLVESRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPEVTWYGWDGDRLTTIQNDRTRI
QTVYQPGSFTPLIRVETATGELAKTQRRSLADALQQSGGEDGGDVVFPPVLVQMLDRLESEILTDRVSEESRRWLASCGL
TVEQMQNQMDPVYTPARKIHLYHCDHRGLPLALVSTEGATEWYAEYDEWGNQLSEDNPHQLQQLIRLPGQQYDEESGLYY
NRHRYYDPLQGRYITQDPIGLEGGWNQYVYASIHPTYSIDPLGLIDKPAPVFNRELNSDAYYLAVNNCYSYALNRYGNPG
SRNFGGGGLQPGELSGKEFSKLTCSSIFEASKNDGAKDLDNGSCPSGYHKAQLFIRPHNFIGMGGDYHWYRQDANGEWSD
KQGVGAIRFRGKDPLPPIDYPEKCGTICLPN*

  Nucleotide sequence: 4176 bp    .

>EFF28264 NZ_CP006632:774741-778916 [Escherichia coli PCN033]
ATGAGCGGAAAACCGGCGGCGCGTCAGGGCGACATGACGCAGTATGGCGGTAGCATTGTTCAGGGTTCAGCCGGGGTGCG
CATCGGTGCCCCCACCGGCGTGGCCTGTTCGGTGTGCCCCGGCGGGGTGACGTCCGGCCATCCGGTCAATCCGCTGCTCG
GCGCGAAGGTCCTTCCCGGCGAAACCGACCTTGCCCTGCCCGGCCCGCTGCCGTTCATCCTCTCCCGCACCTACAGCAGT
TACCGGACAAAAACGCCCGCGCCGGTGGGGAGCCTCGGCCCCGGCTGGAAAATGCCCGCGGATATCCGCTTACAGCTGCG
CGATAACACACTGATACTCAGTGATAACGGCGGCAGGAGCCTGTATTTTGAGCACCTGTTTCCCGGTGAGGACGGTTACA
GCCGCAGCGAGTCACTCTGGCTGGTGCGTGGCGGCGTGGCGAAACTGGATGAAGGTCACCGGCTGGCCGCACTCTGGCAG
GCGCTGCCGGAAGAGCTTCGCCTGAGTCCGCATCGTTATCTGGCGACGAACAGTCCGCAGGGGCCGTGGTGGGTACTCGG
CTGGTGTGAGCGGGTGCCGGAGGCGGATGAGGTGCTGCCTGCGCCGCTGCCGCCGTACCGGGTACTGACCGGGCTGGTGG
ACCGCTTCGGGCGCACACAGACGTTCCACCGTGAGGCTGGCGGCGAATTCAGCGGCGTGACGGATGGTGCCGGGCGTCAC
TTCCGGCTGGTACTGACCACGCAGGCGCAGCGGGCAGAAGAAGCCCGGCAGCAGGCCATTTCCGGCGGGACGGAACCGTC
CGCTTTTCCTGATACCCTGCCGGGTTACACCGAATATGGCCGGGACAACGGCATCCGTCTGTCTGCCGTGTGGCTGACGC
ACGACCCGGAATATCCGGATAACCTGCCAGCCGCGCCGCTGGTACGCTATGGCTGGACGCCGCGCGGCGAACTGGCGGCG
GTGTATGACCGCAGCAATACACAGGTGCGCAGCTTTACTTACGATGATAAATACCGGGGCCGGATGGTGGCGCACCGTCA
CACGGGCCGGCCGGAAATCCGTTACCGTTACGACAGCGACGGGCGGGTGACAGAGCAGCTAAACCCGGCAGGCTTAAGCT
ACACGTATCAGTATGAGAAAGACCGCATCACCATCACCGACAGTCTGGACCGCCGTGAAGTGCTGCACACGCAGGGCGAA
GGCGGGCTGAAGCGGGTGGTGAAAAAGGAACACGCGGACGGCAGCGTCACGCAGAGTCAGTTTGATGCGGTGGGCAGGCT
TAAGGCACAGACGGATGCCGCAGGCCGGACAACAGAATACAGCCCGGATGTGGTGACGGGCCTCATCACGCGCATCACCA
CGCCGGATGGCAGGGCATCGGCGTTTTACTATAACCACCACAGCCAGTTAACGTCAGCCACCGGGACTGACGGGCTGGAA
ATACGCTGGGAATATGATGAATCCGGCCGTCTGATTCAGGAAACTGCCCCTGACGGCGATATCACCCGCTACCGTTATGA
TAATCCACACAGTGACTTACCCTGCGCAACGGAGGATGCCACCGGCAGCCGGAAAACCATGACATGGAGCCGTTACGGTC
AGTTGCTGACCGTCACTGACTGTTCCGGTTATGTAACCCGTTATGACCATGACCGTTTTGGTCAGGTGACGGCGGTGCAC
CGCGAGGAAGGCCTGAGCCAGTACCGCGCATACGACAGCCGTGGACAGTTAATTGCGGTGAAAGACATGCAGGGCCATGA
AACGCGGTATGAATACAACGCCGCCGGTGACCTGACCGCCGTCATTGCCCCGGACGGCAGCAGAAACGGGACACAGTACG
ATGCGTGGGGAAAGGCCATCCGTACCACGCAGGGCGGTCTGACGCGCAGTATGGAATACGATGCTGCCGGACGGGTCATC
CGCCTGACCAGTGAAAACGGCAGCCACACCACCTTCCGTTACGATGTACTTGACCGGCTGATACAGGAAACCGGCTTTGA
CGGCCGCACACAGCGTTATCACCACGACCTGACCGGCAAACTTATCCGCAGCGAGGATGAGGGGCTGGTCACCCACTGGC
ACTATGACGAAGCAGACCGCCTCACTCACCGCACCGTGAAGGGTGAACCGGCAGAGCAGTGGCAGTATGACGAACGCGGC
TGGCTGACACAAATCAGCCATCTCAGCGAAGGCCACCGGGTGACGGTGCATTACGGGTATGATGAGAAAGGCCGCCTGAC
CGGTGAGCGCCAGACGGTGCATCACCCGCAGACGGAAGCACTGCTCTGGCAGCATGAAACCAGACACGCTTACAACGCGC
AGGGACTGGCGAACCGCTGTATACCGGACAGCCTGCCCGCCGTGGAATGGCTGACCTACGGCAGCGGCTGGCTGTCAGGC
ATGAAACTCGGCGACACACCGCTGGTGGATTTCACCCGCGACCGCCTGCACCGGGAAACGCTGCGCAGCTTCGGCCGTTA
TGAACTCACCACCGCTTACACCCCTGCCGGGCAGTTACAGAGCCAGCATCTGAACAGCCTGCAGTATGACCGCGATTACA
CCTGGAACGACAACGGCGAACTCATCCGCATCAGCAGCCCGCGCCAGACCCGGAGTTACAGCTACAGCGACTCCGGCAGG
CTGACCGGCGTTCACACCACGGCAGCGAACCTTGATATCCGCATCCCGTATGCCACAGACCCGGCAGGTAACCGCCTGCC
CGACCCGGAGCTGCACCCGGACAGCACCCTCAGCATGTGGCCGGATAACCGTATCGCCCGTGACGCGCACTATCTTTACC
GGTATGACCGTCACGGCAGGCTGACAGAGAAAACCGACCTCATCCCGGAAGGGGTTATCCGCACGGATGATGAGCGGACT
CACCAGTACCATTACGACAGTCAGCACCGGCTGGTGCACTACACGCGGACACAATATGCAGAGCCGCTGGTCGAAAGTCG
CTATCTTTACGACCCGCTGGGCCGCAGGGTGGCAAAACGGGTGTGGCGGCGTGAACGGGACCTGACGGGCTGGATGTCGC
TGTCACGGAAACCGGAAGTGACCTGGTACGGCTGGGACGGCGACCGGCTGACCACGATACAGAACGACAGAACCCGCATC
CAGACGGTTTATCAGCCGGGGAGCTTCACGCCACTCATCAGAGTTGAAACTGCCACCGGTGAGCTGGCGAAAACGCAGCG
CCGCAGCCTGGCGGATGCGCTTCAGCAGTCCGGCGGTGAAGACGGTGGTGATGTGGTGTTCCCGCCGGTGCTGGTGCAGA
TGCTCGACCGGCTGGAAAGTGAAATCCTTACTGACCGGGTGAGTGAGGAAAGCCGCCGCTGGCTGGCATCGTGCGGCCTG
ACGGTGGAGCAGATGCAAAACCAGATGGACCCGGTGTACACGCCGGCGCGAAAAATCCACCTGTACCACTGCGACCATCG
CGGCCTGCCGCTGGCGCTTGTCAGCACGGAAGGGGCAACAGAATGGTACGCAGAATACGATGAATGGGGTAACCAGCTGA
GTGAGGATAACCCGCACCAGCTGCAGCAGCTCATCCGCCTGCCGGGTCAGCAGTATGATGAGGAGTCAGGCCTGTATTAC
AACCGCCACCGCTATTATGACCCGCTGCAGGGGCGGTATATCACTCAGGATCCGATTGGGCTGGAAGGCGGGTGGAATCA
GTATGTATATGCTTCCATACATCCAACCTATTCTATTGATCCGTTGGGCTTAATTGATAAACCTGCTCCAGTATTCAATC
GAGAACTAAATTCAGATGCGTATTATCTTGCCGTAAATAATTGCTATTCATATGCTCTAAATAGGTATGGAAATCCTGGG
AGTAGGAATTTTGGCGGCGGAGGATTACAACCTGGAGAATTATCTGGAAAAGAGTTTTCTAAACTCACTTGTAGTAGTAT
TTTTGAAGCGTCAAAAAATGATGGTGCCAAGGATTTAGATAATGGGAGTTGTCCATCTGGTTACCATAAAGCTCAATTGT
TTATTCGTCCTCACAATTTTATAGGAATGGGTGGGGATTATCACTGGTATCGTCAGGATGCAAATGGCGAATGGTCTGAC
AAACAAGGCGTGGGTGCAATTAGATTTAGAGGAAAAGATCCCCTCCCCCCAATAGATTATCCTGAAAAGTGTGGAACGAT
ATGTTTACCAAACTAA